Size:100 ul
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP59999_P050-FITC Conjugated

ARP59999_P050-HRP Conjugated

ARP59999_P050-Biotin Conjugated

COL1A1 Antibody - C-terminal region (ARP59999_P050)

80% of 100
Catalog#: ARP59999_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-125157 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human COL1A1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 86%
Complete computational species homology data Anti-COL1A1 (ARP59999_P050)
Peptide Sequence Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-COL1A1 (ARP59999_P050) antibody is Catalog # AAP59999 (Previous Catalog # AAPP46153)
Datasheets/Manuals Printable datasheet for anti-COL1A1 (ARP59999_P050) antibody
Gene Symbol COL1A1
Official Gene Full Name Collagen, type I, alpha 1
Alias Symbols OI4
NCBI Gene Id 1277
Protein Name Collagen alpha-1(I) chain
Description of Target This gene encodes the pro-alpha1 chains of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.
Swissprot Id P02452
Protein Accession # NP_000079
Nucleotide Accession # NM_000088
Protein Size (# AA) 1464
Molecular Weight 137kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express COL1A1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express COL1A1.
Write Your Own Review
You're reviewing:COL1A1 Antibody - C-terminal region (ARP59999_P050)
Your Rating