Search Antibody, Protein, and ELISA Kit Solutions

COL1A1 Antibody - C-terminal region (ARP59999_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP59999_P050-FITC Conjugated

ARP59999_P050-HRP Conjugated

ARP59999_P050-Biotin Conjugated

Gene Symbol:
COL1A1
Official Gene Full Name:
Collagen, type I, alpha 1
NCBI Gene Id:
1277
Protein Name:
Collagen alpha-1(I) chain
Swissprot Id:
P02452
Protein Accession #:
NP_000079
Nucleotide Accession #:
NM_000088
Alias Symbols:
OI4
Replacement Item:
This antibody may replace item sc-125157 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes the pro-alpha1 chains of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.
Protein Size (# AA):
1464
Molecular Weight:
137kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COL1A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COL1A1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human COL1A1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 86%
Complete computational species homology data:
Anti-COL1A1 (ARP59999_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PDGFB; PDGFA; COL1A2; COL1A1; CAPN1; UBC; BRCA1; BARD1; C12orf57; RNH1; ATP13A2; ELAVL1; ACHE; TMPRSS6; P4HB; PAK1; HTRA1; MATN2; PRELP; TGFBI; BGN; VWF; ITGA2; DDR2; THBS1; TXN; SPARC; CD36; FGF7; IGFBP3; ITGA5; FN1; NID1; DCN; CD93; MMP9; MMP2; COL7A1;
Blocking Peptide:
For anti-COL1A1 (ARP59999_P050) antibody is Catalog # AAP59999 (Previous Catalog # AAPP46153)
Datasheets/Manuals:
Printable datasheet for anti-COL1A1 (ARP59999_P050) antibody

Product Reviews

Average Rating:
3 reviews
5 star
1
4 star
1
3 star
1
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

3 Item(s)

78/03/2019 03:18
  • Overall Experience:
  • Quality:
Primary human lung fibroblasts in WB

Submitted by:
Thomas Thatcher, Ph.D.
University of Rochester

COL1A1

1. Sample type: Primary human lung fibroblasts treated with TGFB for 3 days. Primary human lung fibroblasts treated with TGFB to induce collagen expression and transfected with siRNA.

2. Primary antibody concentration: 1ug/ml. Overnight 4˚ in 5% NFDM

3. Secondary antibody and dilution: Goat anti-Rabbit. 1:2000, 1:5000 in 5% NFDM for 1 hr at room temp.

4. Protocol:
1. PVDF membrane
2. Blocked in 5% NFDM in TBS-T for 30 minutes

0
0
Reply
Show more comments (-2) Hide comments
50/02/2019 00:40
  • Overall Experience:
  • Quality:
Canine tendon in WB

Submitted by:
Jasmine Penny

COL1A1

1. Sample type: Canine tendon lysate

2. Primary antibody dilution: 1:5000

3. Secondary antibody and dilution: 1:7000

4. Protocol: Standard denaturing SDS-PAGE followed by electroblotting onto a PVDF membrane and chemiluminecsent detection.

0
0
Reply
Show more comments (-2) Hide comments
02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: COL1A1 antibody-C-terminal region (ARP59999_P050) in Mouse blastocyte using IHC
Product Page for COL1A1 antibody-C-terminal region (ARP59999_P050)

Researcher: Ivan Bedzhov, PhD, Gurdon Institute, University of Cambridge
Application: IHC
Species + Tissue/Cell type: Species + Tissue/Cell type: Mouse blastocyte
Primary antibody dilution: 1:200
Secondary antibody: Anti-rabbit-Alexa 488
Secondary antibody dilution: 1:200


Questionnaire:
How do Aviva's reagents play a role in your experimental goals?
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5, clear and sharp signal.
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, I plan to use it and evantually publish.
How did you store the antibody after re-suspension? 4 degress
Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)? PFA
How many different experimental trials were conducted using the antibody sample? 3
Primary antibody dilution, incubation time and temperature: At 1:200
Secondary antibody used, dilution, incubation time and temperature: Alexa488
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: Green: Collagen, Blue: DAPI
Did you use an antigen retrieval method? If so, please explain? No
What controls were used in your experiment? Please include your positive control: Blastocyst outgrowth stained for Laminin
Experimental Procedure/Protocols: Fix in 2% PFA in PBS.
Wash 3X PBS
Permeabilize 0.5% Triton-X-100 in PBS, 15 min
Wash 2X PBS
Primary antibody 1:200 in PBS, overnight, 4 degrees
Wash 3X PBS
Secondary antibody 1:200 in PBS, overnight, 4 degress or 2h RT
Wash 3X PBS
0
0
Reply
Show more comments (-2) Hide comments

3 Item(s)

What kind of abuse are you reporting?
    Please, wait...