Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP59998_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP59998_P050-FITC Conjugated

ARP59998_P050-HRP Conjugated

ARP59998_P050-Biotin Conjugated

COL1A1 Antibody - C-terminal region (ARP59998_P050)

Rating:
60% of 100
Catalog#: ARP59998_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-125157 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human COL1A1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-COL1A1 (ARP59998_P050)
Peptide Sequence Synthetic peptide located within the following region: YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-COL1A1 (ARP59998_P050) antibody is Catalog # AAP59998 (Previous Catalog # AAPP46152)
Datasheets/Manuals Printable datasheet for anti-COL1A1 (ARP59998_P050) antibody
Gene Symbol COL1A1
Official Gene Full Name Collagen, type I, alpha 1
Alias Symbols OI4
NCBI Gene Id 1277
Protein Name Collagen alpha-1(I) chain
Description of Target This gene encodes the pro-alpha1 chains of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.
Swissprot Id P02452
Protein Accession # NP_000079
Nucleotide Accession # NM_000088
Protein Size (# AA) 1464
Molecular Weight 137kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express COL1A1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express COL1A1.
Protein Interactions PDGFB; PDGFA; COL1A2; COL1A1; CAPN1; UBC; BRCA1; BARD1; C12orf57; RNH1; ATP13A2; ELAVL1; ACHE; TMPRSS6; P4HB; PAK1; HTRA1; MATN2; PRELP; TGFBI; BGN; VWF; ITGA2; DDR2; THBS1; TXN; SPARC; CD36; FGF7; IGFBP3; ITGA5; FN1; NID1; DCN; CD93; MMP9; MMP2; COL7A1;
  1. What is the species homology for "COL1A1 Antibody - C-terminal region (ARP59998_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "COL1A1 Antibody - C-terminal region (ARP59998_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "COL1A1 Antibody - C-terminal region (ARP59998_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "COL1A1 Antibody - C-terminal region (ARP59998_P050)"?

    This target may also be called "OI4" in publications.

  5. What is the shipping cost for "COL1A1 Antibody - C-terminal region (ARP59998_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "COL1A1 Antibody - C-terminal region (ARP59998_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "COL1A1 Antibody - C-terminal region (ARP59998_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "137kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "COL1A1 Antibody - C-terminal region (ARP59998_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "COL1A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "COL1A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "COL1A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "COL1A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "COL1A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "COL1A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:COL1A1 Antibody - C-terminal region (ARP59998_P050)
Your Rating
We found other products you might like!