Catalog No: ARP53621_P050
Price: $0.00
SKU
ARP53621_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

COIL Antibody - C-terminal region (ARP53621_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-COIL (ARP53621_P050) antibody
Product Info
ReferenceWhittom,A.A., Cell. Mol. Life Sci. 65 (7-8), 1256-1271 (2008)
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human COIL
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 82%
Peptide SequenceSynthetic peptide located within the following region: DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-COIL (ARP53621_P050) antibody is Catalog # AAP53621 (Previous Catalog # AAPP30461)
Gene SymbolCOIL
Gene Full NameCoilin
Alias SymbolsCLN80, p80-coilin
NCBI Gene Id8161
Protein NameCoilin
Description of TargetCOIL is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies.The protein encoded by this gene is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies. This gene has pseudogenes on chromosome 4 and chromosome 14. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP38432
Protein Accession #NP_004636
Nucleotide Accession #NM_004645
Protein Size (# AA)576
Molecular Weight63kDa
Protein InteractionsMFAP1; FGF12; BYSL; WDR34; ZCCHC10; ARMCX1; ZNF277; PDLIM5; CDC23; SNRPF; PTS; POLR2L; PDE4D; DRG1; WWOX; UBL5; CSNK2A2; UBC; VCP; TAF9; LACTB2; KYNU; SMN2; SMN1; GTF2F1; APP; UBD; PLEKHG4; KAZN; PSME3; FAM115A; SART3; PREPL; FXR2; PICK1; FHL5; DNAJA3; KA
  1. What is the species homology for "COIL Antibody - C-terminal region (ARP53621_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "COIL Antibody - C-terminal region (ARP53621_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "COIL Antibody - C-terminal region (ARP53621_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "COIL Antibody - C-terminal region (ARP53621_P050)"?

    This target may also be called "CLN80, p80-coilin" in publications.

  5. What is the shipping cost for "COIL Antibody - C-terminal region (ARP53621_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "COIL Antibody - C-terminal region (ARP53621_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "COIL Antibody - C-terminal region (ARP53621_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "63kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "COIL Antibody - C-terminal region (ARP53621_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "COIL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "COIL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "COIL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "COIL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "COIL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "COIL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:COIL Antibody - C-terminal region (ARP53621_P050)
Your Rating
We found other products you might like!