Cobra venom factor Recombinant Protein (Monocled cobra) (OPCA03350)

Catalog No: OPCA03350

Cobra venom factor Recombinant Protein (Naja kaouthia) (OPCA03350) in SDS-PAGE showing the molecular weight of approximately 55.07 kDa.

Cobra venom factor Recombinant Protein (Naja kaouthia) (OPCA03350) in SDS-PAGE showing the molecular weight of approximately 55.07 kDa.

Product Info

• Predicted Species Reactivity: Naja kaouthia
• Product Format: Liquid or Lyophilized powder
• Reconstitution and Storage: -20°C or -80°C
• Purification: Affinity purified using IMAC.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQIIENSIDGSKLN
• Protein Sequence: DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQIIENSIDGSKLN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 733-984 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Molecular cloning and derived primary structure of cobra venom factor.Fritzinger D.C., Bredehorst R., Vogel C.-W.Proc. Natl. Acad. Sci. U.S.A. 91:12775-12779(1994)
• Warning: For research use only.

Target Info

• Alias Symbols: Complement C3 homolog.
• Protein Name: Cobra venom factor
• Description of Target: Complement-activating protein in cobra venom. It is a structural and functional analog of complement component C3b, the activated form of C3. It binds factor B (CFB), which is subsequently cleaved by factor D (CFD) to form the bimolecular complex CVF/Bb. CVF/Bb is a C3/C5 convertase that cleaves both complement components C3 and C5. Structurally, it resembles the C3b degradation product C3c, which is not able to form a C3/C5 convertase. Unlike C3b/Bb, CVF/Bb is a stable complex and completely resistant to the actions of complement regulatory factors H (CFH) and I (CFI). Therefore, CVF continuously activates complement resulting in the depletion of complement activity.
• Uniprot ID: Q91132
• Protein Size (# AA): Recombinant
• Molecular Weight: 44.4 kDa