Cobra venom factor Recombinant Protein (Monocled cobra) (OPCA03350)

Catalog No: OPCA03350

Cobra venom factor Recombinant Protein (Naja kaouthia) (OPCA03350) in SDS-PAGE showing the molecular weight of approximately 55.07 kDa.

Product Info

• Predicted Species Reactivity: Monocled cobra
• Product Format: Liquid or Lyophilized powder
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
  Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
• Purification: Affinity purified using IMAC.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQIIENSIDGSKLN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E. Coli
• Protein Range: 733-984 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Molecular cloning and derived primary structure of cobra venom factor.Fritzinger D.C., Bredehorst R., Vogel C.-W.Proc. Natl. Acad. Sci. U.S.A. 91:12775-12779(1994)
• Warning: For research use only.

Target Info

• Alias Symbols: Complement C3 homolog
• Description of Target: Complement-activating protein in cobra venom. It is a structural and functional analog of complement component C3b, the activated form of C3. It binds factor B (CFB), which is subsequently cleaved by factor D (CFD) to form the bimolecular complex CVF/Bb. CVF/Bb is a C3/C5 convertase that cleaves both complement components C3 and C5. Structurally, it resembles the C3b degradation product C3c, which is not able to form a C3/C5 convertase. Unlike C3b/Bb, CVF/Bb is a stable complex and completely resistant to the actions of complement regulatory factors H (CFH) and I (CFI). Therefore, CVF continuously activates complement resulting in the depletion of complement activity.
• Uniprot ID: Q91132
• Protein Size (# AA): 733-984 aa
• Molecular Weight: 44.4 kDa