Search Antibody, Protein, and ELISA Kit Solutions

CNTN2 Antibody : HRP (ARP32085_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32085_P050 Unconjugated

ARP32085_P050-FITC Conjugated

ARP32085_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
HRP
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
CNTN2
Official Gene Full Name:
contactin 2 (axonal)
NCBI Gene Id:
6900
Protein Name:
Contactin-2
Swissprot Id:
Q02246
Protein Accession #:
NP_005067
Nucleotide Accession #:
NM_005076
Alias Symbols:
AXT, TAX, TAX1, TAG-1,
Description of Target:
The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. It may also be involved in glial tumorigenesis and may provide a potential target for therapeutic intervention.
Protein Size (# AA):
1,040
Molecular Weight:
113 kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CNTN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CNTN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence EESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMN
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-CNTN2 (ARP32085_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMN
Concentration:
0.5 mg/ml
Protein Interactions:
TRAF6; CNTN2; CREBBP; IKBKG; MCM7; MCM6; MCM3; MCM2; KAT2B; EP300; HDAC6; TAX1BP1; UBC; SRF; TAX1BP3; OPTN; HDAC1; SUV39H1; CDK2; HDAC3; SUMO1; SUMO2; SUMO3; IKBKB; EGFR; CHUK; VAC14; NRCAM; CNTN1; CNTNAP2; NCAN; L1CAM; TAB2; UBE2N; TUBG1; STARD13;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-CNTN2 (ARP32085_P050-HRP) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...