Search Antibody, Protein, and ELISA Kit Solutions

CNTN2 Antibody (ARP32085_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32085_P050-FITC Conjugated

ARP32085_P050-HRP Conjugated

ARP32085_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CNTN2
Official Gene Full Name:
contactin 2 (axonal)
NCBI Gene Id:
6900
Protein Name:
Contactin-2
Swissprot Id:
Q02246
Protein Accession #:
NP_005067
Nucleotide Accession #:
NM_005076
Alias Symbols:
AXT, TAX, TAX1, TAG-1,
Description of Target:
The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. It may also be involved in glial tumorigenesis and may provide a potential target for therapeutic intervention.
Protein Size (# AA):
1,040
Molecular Weight:
113 kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CNTN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CNTN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence EESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMN
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-CNTN2 (ARP32085_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMN
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TRAF6; CNTN2; CREBBP; IKBKG; MCM7; MCM6; MCM3; MCM2; KAT2B; EP300; HDAC6; TAX1BP1; UBC; SRF; TAX1BP3; OPTN; HDAC1; SUV39H1; CDK2; HDAC3; SUMO1; SUMO2; SUMO3; IKBKB; EGFR; CHUK; VAC14; NRCAM; CNTN1; CNTNAP2; NCAN; L1CAM; TAB2; UBE2N; TUBG1; STARD13;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-CNTN2 (ARP32085_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...