CNTF Protein (OPPA02121)

Catalog No: OPPA02121 (Formerly GWB-F0BBC9)

Size:5UG

Product Info

• Predicted Species Reactivity: Rat
• Product Format: Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Host: E. Coli
• Additional Information: Solubility: It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100 ug/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
  Biological Activity: Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
  Protein Content: CNTF quantitation was carried out by two independent methods1. UV spectroscopy at 280 nm using the absorbency value of 1.22 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of CNTF Recombinant as a Reference Standard.
  Protein Content: CNTF quantitation was carried out by two independent methods1. UV spectroscopy at 280 nm using the absorbency value of 1.22 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of CNTF Recombinant as a Reference Standard.
  Product Introduction: CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. In addition to the predominant monocistronic transcript originating from this locus, the gene is also co-transcribed with the upstream ZFP91 gene. Co-transcription from the two loci results in a transcript that contains a complete coding region for the zinc finger protein but lacks a complete coding region for ciliary neurotrophic factor.CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
  Product Description: CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.
• Reconstitution and Storage: Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution CNTF should be stored at 4C between 2-7 days and for future use below -18C. Please prevent freeze-thaw cycles.
• Purity: Greater than 99.0% as determined by (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
• Peptide Sequence: AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.

Target Info

• Gene Symbol: rCNTF
• Alias Symbols: HCNTF, CNTF, Ciliary Neurotrophic Factor, CNTF Rat, Ciliary Neurotrophic Factor Rat Recombinant
• NCBI Gene Id: 25707
• Protein Name: Ciliary neurotrophic factor
• Description of Target: Recombinant Rat Ciliary Neurotrophic Factor
• Uniprot ID: P20294
• Protein Accession #: NP_037298.1
• Protein Size (# AA): Recombinant