Search Antibody, Protein, and ELISA Kit Solutions

CNR2 antibody - C-terminal region (ARP63486_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP63486_P050-FITC Conjugated

ARP63486_P050-HRP Conjugated

ARP63486_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Cannabinoid receptor 2 (macrophage)
Protein Name:
Cannabinoid receptor 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CB2, CX5
Replacement Item:
This antibody may replace item sc-10071 from Santa Cruz Biotechnology.
Description of Target:
The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CNR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CNR2.
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Horse: 83%; Human: 100%; Mouse: 79%; Rat: 86%
Complete computational species homology data:
Anti-CNR2 (ARP63486_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CNR2 (ARP63486_P050) antibody is Catalog # AAP63486
Printable datasheet for anti-CNR2 (ARP63486_P050) antibody
Sample Type Confirmation:

CNR2 is supported by BioGPS gene expression data to be expressed in 721_B


Wilhelmsen, K. et al. The endocannabinoid/endovanilloid N-arachidonoyl dopamine (NADA) and synthetic cannabinoid WIN55,212-2 abate the inflammatory activation of human endothelial cells. J. Biol. Chem. 289, 13079-100 (2014). WB, Horse, Human, Mouse, Rat 24644287

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...