Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP63486_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP63486_P050-FITC Conjugated

ARP63486_P050-HRP Conjugated

ARP63486_P050-Biotin Conjugated

CNR2 Antibody - C-terminal region (ARP63486_P050)

Catalog#: ARP63486_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10071 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Horse: 83%; Human: 100%; Mouse: 79%; Rat: 86%
Complete computational species homology data Anti-CNR2 (ARP63486_P050)
Peptide Sequence Synthetic peptide located within the following region: MVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CNR2 (ARP63486_P050) antibody is Catalog # AAP63486
Datasheets/Manuals Printable datasheet for anti-CNR2 (ARP63486_P050) antibody
Sample Type Confirmation

CNR2 is supported by BioGPS gene expression data to be expressed in 721_B

Publications

Wilhelmsen, K. et al. The endocannabinoid/endovanilloid N-arachidonoyl dopamine (NADA) and synthetic cannabinoid WIN55,212-2 abate the inflammatory activation of human endothelial cells. J. Biol. Chem. 289, 13079-100 (2014). WB, Horse, Human, Mouse, Rat 24644287

Gene Symbol CNR2
Official Gene Full Name Cannabinoid receptor 2 (macrophage)
Alias Symbols CB2, CX5
NCBI Gene Id 1269
Protein Name Cannabinoid receptor 2
Description of Target The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors.
Swissprot Id P34972
Protein Accession # NP_001832
Nucleotide Accession # NM_001841
Protein Size (# AA) 360
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CNR2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CNR2.
Protein Interactions GNA15;
  1. What is the species homology for "CNR2 Antibody - C-terminal region (ARP63486_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Horse, Human, Mouse, Rat".

  2. How long will it take to receive "CNR2 Antibody - C-terminal region (ARP63486_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CNR2 Antibody - C-terminal region (ARP63486_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CNR2 Antibody - C-terminal region (ARP63486_P050)"?

    This target may also be called "CB2, CX5" in publications.

  5. What is the shipping cost for "CNR2 Antibody - C-terminal region (ARP63486_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CNR2 Antibody - C-terminal region (ARP63486_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CNR2 Antibody - C-terminal region (ARP63486_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CNR2 Antibody - C-terminal region (ARP63486_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CNR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CNR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CNR2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CNR2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CNR2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CNR2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CNR2 Antibody - C-terminal region (ARP63486_P050)
Your Rating
We found other products you might like!