CNPY2 Antibody - middle region (ARP68229_P050)

Catalog No: ARP68229_P050

Host: Rabbit
Target Name: CNPY2
Sample Type: Placenta lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CNPY2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVG
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP68229

Target Info

• Gene Symbol: CNPY2
• Alias Symbols: MSAP, TMEM4, ZSIG9, HP10390
• NCBI Gene Id: 10330
• Protein Name: Protein canopy homolog 2
• Description of Target: CNPY2 is a positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.
• Uniprot ID: Q9Y2B0
• Protein Accession #: NP_055070
• Nucleotide Accession #: NM_014255
• Protein Size (# AA): 182
• Molecular Weight: 20kDa
• Protein Interactions: UBC; APP; MYLIP; MLXIP;