Catalog No: ARP38511_P050
Price: $0.00
SKU
ARP38511_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Cnot8 (ARP38511_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: AFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDCAQEKMSILAM
Concentration0.5 mg/ml
Blocking PeptideFor anti-Cnot8 (ARP38511_P050) antibody is Catalog # AAP38511
Subunit8
Gene SymbolCnot8
Gene Full NameCCR4-NOT transcription complex, subunit 8
Alias SymbolsAA536816, AU015770, AU043059, 1500015I04Rik, 1810022F04Rik
NCBI Gene Id69125
Protein NameCCR4-NOT transcription complex subunit 8
Description of TargetCnot8 is a ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex.
Uniprot IDQ9D8X5
Protein Accession #NP_081225
Nucleotide Accession #NM_026949
Protein Size (# AA)292
Molecular Weight33kDa
Protein InteractionsTlx3; Btg2; Btg1;
  1. What is the species homology for "Cnot8 Antibody - C-terminal region (ARP38511_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "Cnot8 Antibody - C-terminal region (ARP38511_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Cnot8 Antibody - C-terminal region (ARP38511_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Cnot8 Antibody - C-terminal region (ARP38511_P050)"?

    This target may also be called "AA536816, AU015770, AU043059, 1500015I04Rik, 1810022F04Rik" in publications.

  5. What is the shipping cost for "Cnot8 Antibody - C-terminal region (ARP38511_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Cnot8 Antibody - C-terminal region (ARP38511_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Cnot8 Antibody - C-terminal region (ARP38511_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Cnot8 Antibody - C-terminal region (ARP38511_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CNOT8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CNOT8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CNOT8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CNOT8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CNOT8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CNOT8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Cnot8 Antibody - C-terminal region (ARP38511_P050)
Your Rating
We found other products you might like!