CNOT4 Antibody - middle region : Biotin (ARP57877_P050-Biotin)

Catalog No: ARP57877_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNOT4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFST
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CNOT4 (ARP57877_P050-Biotin) antibody is Catalog # AAP57877 (Previous Catalog # AAPP32230)
• Sample Type Confirmation:

  CNOT4 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226

• Subunit: 4
• Reference: Winkler,G.S., (2004) J. Mol. Biol. 337 (1), 157-165

Target Info

• Gene Symbol: CNOT4
• Gene Full Name: CCR4-NOT transcription complex, subunit 4
• Alias Symbols: NOT4, NOT4H, CLONE243
• NCBI Gene Id: 4850
• Protein Name: CCR4-NOT transcription complex subunit 4
• Description of Target: CNOT4 has E3 ubiquitin ligase activity. The CCR4-NOT complex functions as general transcription regulation complex.
• Uniprot ID: O95628
• Protein Accession #: NP_037448
• Nucleotide Accession #: NM_013316
• Protein Size (# AA): 639
• Molecular Weight: 70kDa
• Protein Interactions: EP300; UBE2D1; UBC5; CNOT1; UBE2E3; UBE2E1; UBE2D2; UBC; CNOT4; ELAVL1; KDM5C; UBE2W; UBE2D4; UBE2N; UBE2D3; CNOT8; UBE2B; CDC39;