Search Antibody, Protein, and ELISA Kit Solutions

CNOT2 Antibody - middle region (ARP32721_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32721_P050-FITC Conjugated

ARP32721_P050-HRP Conjugated

ARP32721_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CNOT2
Official Gene Full Name:
CCR4-NOT transcription complex, subunit 2
NCBI Gene Id:
4848
Protein Name:
CCR4-NOT transcription complex subunit 2
Swissprot Id:
Q9NZN8
Protein Accession #:
NP_055330
Nucleotide Accession #:
NM_014515
Alias Symbols:
CDC36, HSPC131, NOT2, NOT2H
Replacement Item:
This antibody may replace item sc-133470 from Santa Cruz Biotechnology.
Description of Target:
The CCR4-NOT complex functions as general transcription regulation complex.
Protein Size (# AA):
540
Molecular Weight:
60kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CNOT2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CNOT2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CNOT2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-CNOT2 (ARP32721_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; RNF219; NLK; CNOT6L; CNOT6; VCP; Cnot3; NCOR2; NCOR1; HDAC3; GPS2; DDB1; CNOT1; CNOT8; CDC39;
Blocking Peptide:
For anti-CNOT2 (ARP32721_P050) antibody is Catalog # AAP32721 (Previous Catalog # AAPP03735)
Datasheets/Manuals:
Printable datasheet for anti-CNOT2 (ARP32721_P050) antibody
Subunit:
2
Target Reference:
Jayne,S., (2006) Biochem. J. 398 (3), 461-467

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...