CNN2 Antibody - N-terminal region (ARP52039_P050)

Catalog No: ARP52039_P050

WB Suggested Anti-CNN2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateCNN2 is supported by BioGPS gene expression data to be expressed in HepG2

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CNN2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CNN2 (ARP52039_P050) antibody is Catalog # AAP52039 (Previous Catalog # AAPP30264)
• Sample Type Confirmation:

  CNN2 is supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Gevaert,K., (2003) Nat. Biotechnol. 21 (5), 566-569

Target Info

• Gene Symbol: CNN2
• Gene Full Name: Calponin 2
• Alias Symbols: -
• NCBI Gene Id: 1265
• Protein Name: Calponin-2
• Description of Target: CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q99439
• Protein Accession #: NP_004359
• Nucleotide Accession #: NM_004368
• Protein Size (# AA): 309
• Molecular Weight: 34kDa
• Protein Interactions: UBC; MAT2B; ERP44; PDCD10; FUBP1; LAGE3; CD81; PAN2; FN1; ZYX; TPM1; FSCN1; HNRNPH2; ACTA2; ELAVL1; ACTB;