CNMD Antibody - N-terminal region (ARP44615_P050)

Catalog No: ARP44615_P050

Host: Rabbit
Target Name: LECT1
Sample Tissue: Human 786-0
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LECT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CNMD (ARP44615_P050) antibody is Catalog # AAP44615 (Previous Catalog # AAPP25881)
• Sample Type Confirmation:

  LECT1 is supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Lafont,J.E., (2008) J. Biol. Chem. 283 (8), 4778-4786

Target Info

• Gene Symbol: CNMD
• Gene Full Name: chondromodulin
• Alias Symbols: CHM1, CHM-I, LECT1, BRICD3, MYETS1
• NCBI Gene Id: 11061
• Protein Name: leukocyte cell-derived chemotaxin 1
• Description of Target: This gene encodes a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein although no biological activity has yet been defined for it. The C-terminus of the precursor protein contains a 25 kDa mature protein called leukocyte cell-derived chemotaxin-1 or chondromodulin-1. The mature protein promotes chondrocyte growth and inhibits angiogenesis. This gene is expressed in the avascular zone of prehypertrophic cartilage and its expression decreases during chondrocyte hypertrophy and vascular invasion. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Uniprot ID: O75829
• Protein Accession #: NP_008946
• Nucleotide Accession #: NM_007015
• Protein Size (# AA): 334
• Molecular Weight: 37kDa
• Protein Interactions: MYC; APOA1; FURIN;