CMTM2 Antibody - N-terminal region (ARP31565_P050)

Catalog No: ARP31565_P050

WB Suggested Anti-CMTM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CMTM2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 87%; Dog: 87%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CMTM2 (ARP31565_P050) antibody is Catalog # AAP31565 (Previous Catalog # AAPP02343)
• Reference: Liu,G., (2007) Asian J. Androl. 9 (2), 189-198

Target Info

• Gene Symbol: CMTM2
• Gene Full Name: CKLF-like MARVEL transmembrane domain containing 2
• Alias Symbols: CKLFSF2
• NCBI Gene Id: 146225
• Protein Name: CKLF-like MARVEL transmembrane domain-containing protein 2
• Description of Target: CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development.
• Uniprot ID: Q8TAZ6
• Protein Accession #: NP_653274
• Nucleotide Accession #: NM_144673
• Protein Size (# AA): 248
• Molecular Weight: 27kDa
• Protein Interactions: APP;