SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP70642_P050
Price: $0.00
SKU
ARP70642_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CLUH (ARP70642_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human CLUH
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 83%
Peptide SequenceSynthetic peptide located within the following region: SVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPLQPQNRDW
Concentration0.5 mg/ml
Blocking PeptideFor anti-CLUH (ARP70642_P050) antibody is Catalog # AAP70642
Enhanced Validation
WBY
SPR
YCHAROS
Publications

Characterization of Factors Involved in Localized Translation Near Mitochondria by Ribosome-Proximity Labeling. Front Cell Dev Biol. 7, 305 (2020). 31929983

CLUH granules coordinate translation of mitochondrial proteins with mTORC1 signaling and mitophagy. EMBO J. 39, e102731 (2020). 32149416

CLUH regulates mitochondrial metabolism by controlling translation and decay of target mRNAs. J Cell Biol. 216, 675-693 (2017). 28188211

Description
Gene SymbolCLUH
Alias SymbolsCLU1
NCBI Gene Id23277
Protein NameClustered mitochondria protein homolog
Description of TargetCLUH is involved in proper cytoplasmic distribution of mitochondria.
Uniprot IDO75153
Protein Accession #NP_056044
Nucleotide Accession #NM_015229
Protein Size (# AA)1309
Molecular Weight147 kDa
Protein InteractionsSUMO2; UBC; HSP90AB2P; APPL1; CYFIP1; NCKAP1; TRIM16; MCM7; MCM4; UBD; SIRT7; CELSR3;
  1. What is the species homology for "CLUH Antibody - N-terminal region (ARP70642_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "CLUH Antibody - N-terminal region (ARP70642_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CLUH Antibody - N-terminal region (ARP70642_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CLUH Antibody - N-terminal region (ARP70642_P050)"?

    This target may also be called "CLU1" in publications.

  5. What is the shipping cost for "CLUH Antibody - N-terminal region (ARP70642_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CLUH Antibody - N-terminal region (ARP70642_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CLUH Antibody - N-terminal region (ARP70642_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "147 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CLUH Antibody - N-terminal region (ARP70642_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CLUH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CLUH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CLUH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CLUH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CLUH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CLUH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CLUH Antibody - N-terminal region (ARP70642_P050)
Your Rating
We found other products you might like!