CLUH Antibody - N-terminal region (ARP70642_P050)

Catalog No: ARP70642_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: CLUH
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: KIAA0664
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml

Host: Rabbit
Target: CLUH
Positive control (+): HeLa Cell Lysate (HL)
Negative control (-): Human Liver Tumor (T-LI)
Antibody concentration: 3ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IP
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLUH
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 83%
• Peptide Sequence: Synthetic peptide located within the following region: SVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPLQPQNRDW
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CLUH (ARP70642_P050) antibody is Catalog # AAP70642
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Publications:

  Characterization of Factors Involved in Localized Translation Near Mitochondria by Ribosome-Proximity Labeling. Front Cell Dev Biol. 7, 305 (2020). 31929983

  CLUH granules coordinate translation of mitochondrial proteins with mTORC1 signaling and mitophagy. EMBO J. 39, e102731 (2020). 32149416

  CLUH regulates mitochondrial metabolism by controlling translation and decay of target mRNAs. J Cell Biol. 216, 675-693 (2017). 28188211

Target Info

• Gene Symbol: CLUH
• Alias Symbols: CLU1
• NCBI Gene Id: 23277
• Protein Name: Clustered mitochondria protein homolog
• Description of Target: CLUH is involved in proper cytoplasmic distribution of mitochondria.
• Uniprot ID: O75153
• Protein Accession #: NP_056044
• Nucleotide Accession #: NM_015229
• Protein Size (# AA): 1309
• Molecular Weight: 147 kDa
• Protein Interactions: SUMO2; UBC; HSP90AB2P; APPL1; CYFIP1; NCKAP1; TRIM16; MCM7; MCM4; UBD; SIRT7; CELSR3;