Clta Antibody - C-terminal region (ARP59988_P050)

Catalog No: ARP59988_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: Clta
Sample Type: Rat Kidney lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Clta
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: EQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Clta (ARP59988_P050) antibody is Catalog # AAP59988

Target Info

• Gene Symbol: Clta
• Gene Full Name: clathrin, light chain B
• Alias Symbols: LCA1, LCA2, LCA3
• NCBI Gene Id: 83800
• Protein Name: Clathrin light chain A
• Description of Target: Clta is a light chain component of the clathrin triskelion structure of coated vesicles.
• Uniprot ID: P08081
• Protein Accession #: NP_114180
• Nucleotide Accession #: NM_031974
• Protein Size (# AA): 248
• Molecular Weight: 27kDa
• Protein Interactions: STXBP5L; Ubc; Epn1; Dab2; Bin1; Amph; Park7; Vcp;