CLPB Antibody - N-terminal region : HRP (ARP53790_P050-HRP)

Catalog No: ARP53790_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CLPB
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 77%; Rabbit: 85%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CLPB (ARP53790_P050-HRP) antibody is Catalog # AAP53790 (Previous Catalog # AAPP30852)
• Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Target Info

• Gene Symbol: CLPB
• Gene Full Name: ClpB caseinolytic peptidase B homolog (E. coli)
• Alias Symbols: SKD3, HSP78, MGCA7, ANKCLB, MEGCANN
• NCBI Gene Id: 81570
• Protein Name: Caseinolytic peptidase B protein homolog
• Description of Target: CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.
• Uniprot ID: Q9H078
• Protein Accession #: NP_110440
• Nucleotide Accession #: NM_030813
• Protein Size (# AA): 707
• Molecular Weight: 78kDa
• Protein Interactions: CEP70; IRS4; UBC; HDAC11; MDFI; SMAD9; CUL3; TERF2; UCHL3; OSBPL10; USP30; COPS6; TTF2;