Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CLN6 antibody - C-terminal region (ARP47372_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP47372_P050-FITC Conjugated

ARP47372_P050-HRP Conjugated

ARP47372_P050-Biotin Conjugated

Gene Symbol:
CLN6
NCBI Gene Id:
54982
Official Gene Full Name:
Ceroid-lipofuscinosis, neuronal 6, late infantile, variant
Protein Name:
Ceroid-lipofuscinosis neuronal protein 6
Swissprot Id:
Q9NWW5
Protein Accession #:
NP_060352
Nucleotide Accession #:
NM_017882
Alias Symbols:
FLJ20561, HsT18960, nclf, CLN4A
Replacement Item:
This antibody may replace item sc-113803 from Santa Cruz Biotechnology.
Description of Target:
CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
Protein Size (# AA):
311
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLN6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLN6.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CLN6
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-CLN6 (ARP47372_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RNF2; BMI1; ILK; env; DERL1; VCP; UBC;
Blocking Peptide:
For anti-CLN6 (ARP47372_P050) antibody is Catalog # AAP47372 (Previous Catalog # AAPP28240)
Datasheets/Manuals:
Printable datasheet for anti-CLN6 (ARP47372_P050) antibody
Sample Type Confirmation:

CLN6 is supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Heine,C., (2007) Mol. Membr. Biol. 24 (1), 74-87

Tell us what you think about this item!

Write A Review
    Please, wait...