Search Antibody, Protein, and ELISA Kit Solutions

CLN5 Antibody - C-terminal region : HRP (ARP59986_P050-HRP)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP59986_P050 Unconjugated

ARP59986_P050-FITC Conjugated

ARP59986_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
ceroid-lipofuscinosis, neuronal 5
NCBI Gene Id:
Protein Name:
ceroid-lipofuscinosis neuronal protein 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-134808 from Santa Cruz Biotechnology.
Description of Target:
This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
Protein Size (# AA):
Molecular Weight:
39 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLN5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLN5.
The immunogen is a synthetic peptide directed towards the C terminal region of human CLN5
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 77%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 79%
Complete computational species homology data:
Anti-CLN5 (ARP59986_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKN
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CLN5 (ARP59986_P050-HRP) antibody is Catalog # AAP59986
Printable datasheet for anti-CLN5 (ARP59986_P050-HRP) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...