CLN5 Antibody - C-terminal region : Biotin (ARP59986_P050-Biotin)

Catalog No: ARP59986_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLN5
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: DNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CLN5 (ARP59986_P050-Biotin) antibody is Catalog # AAP59986

Target Info

• Gene Symbol: CLN5
• Gene Full Name: ceroid-lipofuscinosis, neuronal 5
• Alias Symbols: NCL
• NCBI Gene Id: 1203
• Protein Name: ceroid-lipofuscinosis neuronal protein 5
• Description of Target: This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
• Uniprot ID: O75503
• Protein Accession #: NP_006484
• Nucleotide Accession #: NM_006493.2
• Protein Size (# AA): 358
• Molecular Weight: 39 kDa
• Protein Interactions: ARHGAP36; FBXO27; SPNS1; SFXN3; SLC25A22; SEC61A1; FBXO6; PHGDH; GANAB; OS9; CDIPT; SLC25A13; CDS2; SLC25A11; XPO1; SLC25A1; SEL1L; RPN1; RCN2; HMGCS1; DBH; CLN5; CLGN; CANX; CALU; CALR; ATP2A2; ATP1A3; ARF4; SLC25A6; SLC25A5; SLC25A4; Dlg4; UBC; KRT8;