Search Antibody, Protein, and ELISA Kit Solutions

CLN5 Antibody - C-terminal region (ARP59986_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP59986_P050-FITC Conjugated

ARP59986_P050-HRP Conjugated

ARP59986_P050-Biotin Conjugated

Gene Symbol:
CLN5
Official Gene Full Name:
ceroid-lipofuscinosis, neuronal 5
NCBI Gene Id:
1203
Protein Name:
ceroid-lipofuscinosis neuronal protein 5
Swissprot Id:
O75503
Protein Accession #:
NP_006484
Nucleotide Accession #:
NM_006493.2
Alias Symbols:
NCL
Replacement Item:
This antibody may replace item sc-134808 from Santa Cruz Biotechnology.
Description of Target:
This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
Protein Size (# AA):
358
Molecular Weight:
39 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLN5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLN5.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CLN5
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 77%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 79%
Complete computational species homology data:
Anti-CLN5 (ARP59986_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ARHGAP36; FBXO27; SPNS1; SFXN3; SLC25A22; SEC61A1; FBXO6; PHGDH; GANAB; OS9; CDIPT; SLC25A13; CDS2; SLC25A11; XPO1; SLC25A1; SEL1L; RPN1; RCN2; HMGCS1; DBH; CLN5; CLGN; CANX; CALU; CALR; ATP2A2; ATP1A3; ARF4; SLC25A6; SLC25A5; SLC25A4; Dlg4; UBC; KRT8;
Blocking Peptide:
For anti-CLN5 (ARP59986_P050) antibody is Catalog # AAP59986
Datasheets/Manuals:
Printable datasheet for anti-CLN5 (ARP59986_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...