Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP59986_P050-FITC Conjugated

ARP59986_P050-HRP Conjugated

ARP59986_P050-Biotin Conjugated

CLN5 Antibody - C-terminal region (ARP59986_P050)

Catalog#: ARP59986_P050
Domestic: within 24 hours delivery | International: 3-5 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-134808 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CLN5
Purification Affinity purified
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 79%
Complete computational species homology data Anti-CLN5 (ARP59986_P050)
Peptide Sequence Synthetic peptide located within the following region: DNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CLN5 (ARP59986_P050) antibody is Catalog # AAP59986
Datasheets/Manuals Printable datasheet for anti-CLN5 (ARP59986_P050) antibody
Gene Symbol CLN5
Official Gene Full Name ceroid-lipofuscinosis, neuronal 5
Alias Symbols NCL
NCBI Gene Id 1203
Protein Name ceroid-lipofuscinosis neuronal protein 5
Description of Target This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
Swissprot Id O75503
Protein Accession # NP_006484
Nucleotide Accession # NM_006493.2
Protein Size (# AA) 358
Molecular Weight 39 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CLN5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CLN5.
Protein Interactions ARHGAP36; FBXO27; SPNS1; SFXN3; SLC25A22; SEC61A1; FBXO6; PHGDH; GANAB; OS9; CDIPT; SLC25A13; CDS2; SLC25A11; XPO1; SLC25A1; SEL1L; RPN1; RCN2; HMGCS1; DBH; CLN5; CLGN; CANX; CALU; CALR; ATP2A2; ATP1A3; ARF4; SLC25A6; SLC25A5; SLC25A4; Dlg4; UBC; KRT8;
  1. What is the species homology for "CLN5 Antibody - C-terminal region (ARP59986_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat".

  2. How long will it take to receive "CLN5 Antibody - C-terminal region (ARP59986_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "CLN5 Antibody - C-terminal region (ARP59986_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "CLN5 Antibody - C-terminal region (ARP59986_P050)"?

    This target may also be called "NCL" in publications.

  5. What is the shipping cost for "CLN5 Antibody - C-terminal region (ARP59986_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CLN5 Antibody - C-terminal region (ARP59986_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CLN5 Antibody - C-terminal region (ARP59986_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CLN5 Antibody - C-terminal region (ARP59986_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CLN5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CLN5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CLN5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CLN5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CLN5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CLN5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CLN5 Antibody - C-terminal region (ARP59986_P050)
Your Rating
We found other products you might like!