Catalog No: ARP53774_P050
Price: $0.00
SKU
ARP53774_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CLMN Antibody - C-terminal region (ARP53774_P050)

Datasheets/ManualsPrintable datasheet for anti-CLMN (ARP53774_P050) antibody
Product Info
ReferenceHeilig,R., (2003) Nature 421 (6923), 601-607
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Pig, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CLMN
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 77%; Dog: 77%; Human: 100%; Mouse: 77%; Pig: 85%; Yeast: 92%
Peptide SequenceSynthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI
Concentration0.5 mg/ml
Blocking PeptideFor anti-CLMN (ARP53774_P050) antibody is Catalog # AAP53774 (Previous Catalog # AAPP30616)
Gene SymbolCLMN
Gene Full NameCalmin (calponin-like, transmembrane)
Alias SymbolsFLJ12383, KIAA1188
NCBI Gene Id79789
Protein NameCalmin
Description of TargetCLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.
Uniprot IDQ96JQ2
Protein Accession #NP_079010
Nucleotide Accession #NM_024734
Protein Size (# AA)1002
Molecular Weight110kDa
Protein InteractionsPPP1CC;
  1. What is the species homology for "CLMN Antibody - C-terminal region (ARP53774_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Pig, Yeast".

  2. How long will it take to receive "CLMN Antibody - C-terminal region (ARP53774_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CLMN Antibody - C-terminal region (ARP53774_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CLMN Antibody - C-terminal region (ARP53774_P050)"?

    This target may also be called "FLJ12383, KIAA1188" in publications.

  5. What is the shipping cost for "CLMN Antibody - C-terminal region (ARP53774_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CLMN Antibody - C-terminal region (ARP53774_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CLMN Antibody - C-terminal region (ARP53774_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "110kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CLMN Antibody - C-terminal region (ARP53774_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CLMN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CLMN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CLMN"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CLMN"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CLMN"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CLMN"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CLMN Antibody - C-terminal region (ARP53774_P050)
Your Rating
We found other products you might like!