Search Antibody, Protein, and ELISA Kit Solutions

CLMN Antibody - C-terminal region (ARP53774_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53774_P050-FITC Conjugated

ARP53774_P050-HRP Conjugated

ARP53774_P050-Biotin Conjugated

Gene Symbol:
CLMN
Official Gene Full Name:
Calmin (calponin-like, transmembrane)
NCBI Gene Id:
79789
Protein Name:
Calmin
Swissprot Id:
Q96JQ2
Protein Accession #:
NP_079010
Nucleotide Accession #:
NM_024734
Alias Symbols:
FLJ12383, KIAA1188
Replacement Item:
This antibody may replace item sc-141981 from Santa Cruz Biotechnology.
Description of Target:
CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.
Protein Size (# AA):
1002
Molecular Weight:
110kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLMN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLMN.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CLMN
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Yeast
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 77%; Dog: 77%; Human: 100%; Mouse: 77%; Pig: 85%; Yeast: 92%
Complete computational species homology data:
Anti-CLMN (ARP53774_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PPP1CC;
Blocking Peptide:
For anti-CLMN (ARP53774_P050) antibody is Catalog # AAP53774 (Previous Catalog # AAPP30616)
Datasheets/Manuals:
Printable datasheet for anti-CLMN (ARP53774_P050) antibody
Target Reference:
Heilig,R., (2003) Nature 421 (6923), 601-607

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...