Search Antibody, Protein, and ELISA Kit Solutions

CLIC5 Antibody - middle region (ARP35262_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35262_T100-FITC Conjugated

ARP35262_T100-HRP Conjugated

ARP35262_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Chloride intracellular channel 5
NCBI Gene Id:
Protein Name:
Chloride intracellular channel protein 5
Swissprot Id:
Alias Symbols:
MST130, MSTP130
Replacement Item:
This antibody may replace item sc-133468 from Santa Cruz Biotechnology.
Description of Target:
CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli. CLIon Channel-5A has a role as a chloride channel in vitro and binds to cortical actin cytoskeleton.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLIC5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLIC5.
The immunogen is a synthetic peptide directed towards the middle region of human CLIC5
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-CLIC5 (ARP35262_T100)
Peptide Sequence:
Synthetic peptide located within the following region: HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CLIC5 (ARP35262_T100) antibody is Catalog # AAP35262 (Previous Catalog # AAPP06496)
Printable datasheet for anti-CLIC5 (ARP35262_T100) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that CLIC5 is expressed in Jurkat

Target Reference:
Berryman,M., et al., (2004) J. Biol. Chem. 279(33):34794-801

Li, F.-N. et al. Chloride intracellular channel 5 modulates adipocyte accumulation in skeletal muscle by inhibiting preadipocyte differentiation. J. Cell. Biochem. 110, 1013-21 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 20564201

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...