Size:100 ul
$249.00
In stock
SKU
ARP35262_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35262_T100-FITC Conjugated

ARP35262_T100-HRP Conjugated

ARP35262_T100-Biotin Conjugated

CLIC5 Antibody - middle region (ARP35262_T100)

Catalog#: ARP35262_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133468 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CLIC5
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-CLIC5 (ARP35262_T100)
Peptide Sequence Synthetic peptide located within the following region: HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CLIC5 (ARP35262_T100) antibody is Catalog # AAP35262 (Previous Catalog # AAPP06496)
Datasheets/Manuals Printable datasheet for anti-CLIC5 (ARP35262_T100) antibody
Sample Type Confirmation

There is BioGPS gene expression data showing that CLIC5 is expressed in Jurkat

Target Reference Berryman,M., et al., (2004) J. Biol. Chem. 279(33):34794-801
Publications

Li, F.-N. et al. Chloride intracellular channel 5 modulates adipocyte accumulation in skeletal muscle by inhibiting preadipocyte differentiation. J. Cell. Biochem. 110, 1013-21 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 20564201

Gene Symbol CLIC5
Official Gene Full Name Chloride intracellular channel 5
Alias Symbols MST130, MSTP130
NCBI Gene Id 53405
Protein Name Chloride intracellular channel protein 5
Description of Target CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli. CLIon Channel-5A has a role as a chloride channel in vitro and binds to cortical actin cytoskeleton.
Swissprot Id Q9NZA1
Protein Size (# AA) 410
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CLIC5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CLIC5.
Protein Interactions SRPK1; FN1; IQGAP1; GSN; EZR; ACTA1; ACTN1;
Write Your Own Review
You're reviewing:CLIC5 Antibody - middle region (ARP35262_T100)
Your Rating