Search Antibody, Protein, and ELISA Kit Solutions

CLIC5 Antibody - C-terminal region (ARP35263_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35263_T100-FITC Conjugated

ARP35263_T100-HRP Conjugated

ARP35263_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Chloride intracellular channel 5
NCBI Gene Id:
Protein Name:
Chloride intracellular channel protein 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MST130, MSTP130
Replacement Item:
This antibody may replace item sc-133468 from Santa Cruz Biotechnology.
Description of Target:
Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLIC5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLIC5.
The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC5
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-CLIC5 (ARP35263_T100)
Peptide Sequence:
Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CLIC5 (ARP35263_T100) antibody is Catalog # AAP35263
Printable datasheet for anti-CLIC5 (ARP35263_T100) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that CLIC5 is expressed in Jurkat

Target Reference:
Otsuki,T., (2005) DNA Res. 12 (2), 117-126

Tavasoli, M; Al-Momany, A; Wang, X; Li, L; Edwards, JC; Ballermann, BJ; Both CLIC4 and CLIC5A activate ERM proteins in glomerular endothelium. 311, F945-F957 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27582103

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...