Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35045_T100-FITC Conjugated

ARP35045_T100-HRP Conjugated

ARP35045_T100-Biotin Conjugated

CLIC1 Antibody - N-terminal region (ARP35045_T100)

100% of 100
Catalog#: ARP35045_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-271051 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CLIC1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-CLIC1 (ARP35045_T100)
Peptide Sequence Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CLIC1 (ARP35045_T100) antibody is Catalog # AAP35045 (Previous Catalog # AAPP06272)
Datasheets/Manuals Printable datasheet for anti-CLIC1 (ARP35045_T100) antibody
Target Reference Novarino,G., et al., (2004) J. Neurosci. 24 (23), 5322-5330

Yang, J.-Y. et al. Chloride intracellular channel 1 regulates osteoblast differentiation. Bone 45, 1175-85 (2009). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19703605

Gene Symbol CLIC1
Official Gene Full Name Chloride intracellular channel 1
Alias Symbols G6, NCC27
NCBI Gene Id 1192
Protein Name Chloride intracellular channel protein 1
Description of Target Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
Swissprot Id Q502X1
Protein Accession # NP_001279
Nucleotide Accession # NM_001288
Protein Size (# AA) 241
Molecular Weight 27kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CLIC1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CLIC1.
  1. What is the species homology for "CLIC1 Antibody - N-terminal region (ARP35045_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "CLIC1 Antibody - N-terminal region (ARP35045_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CLIC1 Antibody - N-terminal region (ARP35045_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "CLIC1 Antibody - N-terminal region (ARP35045_T100)"?

    This target may also be called "G6, NCC27" in publications.

  5. What is the shipping cost for "CLIC1 Antibody - N-terminal region (ARP35045_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CLIC1 Antibody - N-terminal region (ARP35045_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CLIC1 Antibody - N-terminal region (ARP35045_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CLIC1 Antibody - N-terminal region (ARP35045_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CLIC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CLIC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CLIC1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CLIC1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CLIC1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CLIC1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CLIC1 Antibody - N-terminal region (ARP35045_T100)
Your Rating
We found other products you might like!