Search Antibody, Protein, and ELISA Kit Solutions

CLIC1 antibody - N-terminal region (ARP35045_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35045_T100-FITC Conjugated

ARP35045_T100-HRP Conjugated

ARP35045_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Chloride intracellular channel 1
Protein Name:
Chloride intracellular channel protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
G6, NCC27
Replacement Item:
This antibody may replace item sc-271051 from Santa Cruz Biotechnology.
Description of Target:
Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLIC1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLIC1.
The immunogen is a synthetic peptide directed towards the N terminal region of human CLIC1
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-CLIC1 (ARP35045_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CLIC1 (ARP35045_T100) antibody is Catalog # AAP35045 (Previous Catalog # AAPP06272)
Printable datasheet for anti-CLIC1 (ARP35045_T100) antibody
Target Reference:
Novarino,G., et al., (2004) J. Neurosci. 24 (23), 5322-5330

Yang, J.-Y. et al. Chloride intracellular channel 1 regulates osteoblast differentiation. Bone 45, 1175-85 (2009). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19703605

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: CLIC1 antibody-N-terminal region (ARP35045_T100) in mouse renal epithelial lysate using Western blot
Product Page for CLIC1 antibody - N-terminal region (ARP35045_T100)

Researcher: Dr. JUNMING FAN,ECU
Application: Western blotting
Species + Tissue/Cell type: Lane 1: 30ug mouse renal epithelial lysate Lane 2: 30ug mouse renal epithelial lysate Lane 3: 30ug mouse renal epithelial lysate
Primary antibody dilution: 1:500
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:2500

How do Aviva's reagents play a role in your experimental goals? To compare expression levels of a given protein between WT and KO renal epithelial cells.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5; The band is clear and there is no nonspecific band. However, the staining pattern is different from ARP35044 which recognizes the same CLIC1 protein.
Would you use this antibody in future experiments? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. The band is clear and there is no nonspecific band.
How did you store the antibody after re-suspension? Aliquot and store at -20C.
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): MICE;RENAL EPITHELIAL CELLS;30 ug total protein/LANE
How many different experimental trials were conducted using the antibody sample? 4
How was this sample prepared? Confluent cells were washed three times in PBS and then lysed in RIPA buffer (1% Triton X-100, 0.5% sodium deoxycholate, 0.2% SDS, 150 mM NaCl, 10 mM Hepes, pH 7.3, 2 mM EDTA, and protease inhibitor mixture; Pierce). The lysates were homogenized on ice by passing 20 times through a 22-gauge needle and centrifuged at 15,000 g for 15 minutes at 4C. The total protein concentration of each sample was measured using the BCA protein assay kit (Pierce, Rockford, IL, USA).
Primary antibody dilution and incubation time: 1:500; overnight at 4C.
Secondary antibody used and dilution and incubation time: 1:2500;RT FOR ONE HOUR.
What controls were used in your experiment (positive/negative)? NO
Please include your detailed WB Procedure/Protocol here: 1) Confluent cells were homogenized with RIPA buffer.
2) 30 ug of total protein with the Nupage sample buffer were loaded and run with 12% Nupage Gel (200V for 35 minutes).
3) The membrane was blocked in 5% non-fat dried milk, RT, 1 hour.
4) The membrane was incubated with respective primary antibody overnight at 4C.
5) The membrane was washed and then incubated with appropriate secondary antibody (1:2500) , RT, 1 hour.
6) After washing, the signals were detected by ECL.
(Molecular mass was determined relative to protein markers (BioRad).)
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...