Size:100 ul
$249.00
In Stock
SKU
ARP35045_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35045_T100-FITC Conjugated

ARP35045_T100-HRP Conjugated

ARP35045_T100-Biotin Conjugated

CLIC1 Antibody - N-terminal region (ARP35045_T100)

Rating:
100% of 100
Catalog#: ARP35045_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-271051 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CLIC1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology dataAnti-CLIC1 (ARP35045_T100)
Peptide SequenceSynthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CLIC1 (ARP35045_T100) antibody is Catalog # AAP35045 (Previous Catalog # AAPP06272)
Datasheets/ManualsPrintable datasheet for anti-CLIC1 (ARP35045_T100) antibody
Target ReferenceNovarino,G., et al., (2004) J. Neurosci. 24 (23), 5322-5330
Publications

Yang, J.-Y. et al. Chloride intracellular channel 1 regulates osteoblast differentiation. Bone 45, 1175-85 (2009). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19703605

Gene SymbolCLIC1
Official Gene Full NameChloride intracellular channel 1
Alias SymbolsG6, NCC27
NCBI Gene Id1192
Protein NameChloride intracellular channel protein 1
Description of TargetChloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
Swissprot IdQ502X1
Protein Accession #NP_001279
Nucleotide Accession #NM_001288
Protein Size (# AA)241
Molecular Weight27kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CLIC1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CLIC1.
Protein InteractionsUBC; PSMD10; SUMO2; SUMO1; NEDD8; FBXO6; ZNF302; NUP62; PRDX4; IKBKG; ZNF184; VCAM1; THRA; RPLP1; NTF4; ITGA4; FN1; ATF2; CPT1A; ATP6V0A1; ATP6V0C; ATP5F1; ALOX5AP; GRK5; MYOC; CDK2; ISG15; ARRB2; SUMO4; LSM1; AKAP9; TRAPPC2;
Write Your Own Review
You're reviewing:CLIC1 Antibody - N-terminal region (ARP35045_T100)
Your Rating
Aviva Live Chat
Aviva Pathways
Free Microscope
Aviva ChIP Antibodies