Catalog No: ARP53215_P050
Price: $0.00
SKU
ARP53215_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CLECL1 Antibody - middle region (ARP53215_P050)

Datasheets/ManualsPrintable datasheet for anti-CLECL1 (ARP53215_P050) antibody
Product Info
ReferenceRyan,E.J., (2002) J. Immunol. 169 (10), 5638-5648
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CLECL1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK
Concentration0.5 mg/ml
Blocking PeptideFor anti-CLECL1 (ARP53215_P050) antibody is Catalog # AAP53215 (Previous Catalog # AAPP36301)
Gene SymbolCLECL1
Gene Full NameC-type lectin-like 1
Alias SymbolsDCAL1, DCAL-1
NCBI Gene Id160365
Protein NameC-type lectin-like domain family 1
Description of TargetDCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 (IL4; MIM 147780) production. DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 (IL4; MIM 147780) production.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-504 AF518873.1 1-504 505-649 AW237307.1 1-145 c
Uniprot IDQ8IZS7
Protein Accession #NP_742001
Nucleotide Accession #NM_172004
Protein Size (# AA)167
Molecular Weight19kDa
  1. What is the species homology for "CLECL1 Antibody - middle region (ARP53215_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CLECL1 Antibody - middle region (ARP53215_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CLECL1 Antibody - middle region (ARP53215_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CLECL1 Antibody - middle region (ARP53215_P050)"?

    This target may also be called "DCAL1, DCAL-1" in publications.

  5. What is the shipping cost for "CLECL1 Antibody - middle region (ARP53215_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CLECL1 Antibody - middle region (ARP53215_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CLECL1 Antibody - middle region (ARP53215_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CLECL1 Antibody - middle region (ARP53215_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CLECL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CLECL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CLECL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CLECL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CLECL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CLECL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CLECL1 Antibody - middle region (ARP53215_P050)
Your Rating