Size:100 ul
$249.00
In stock
SKU
ARP33617_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33617_T100-FITC Conjugated

ARP33617_T100-HRP Conjugated

ARP33617_T100-Biotin Conjugated

CLDN9 Antibody - C-terminal region (ARP33617_T100)

Catalog#: ARP33617_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-111499 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CLDN9
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology dataAnti-CLDN9 (ARP33617_T100)
Peptide SequenceSynthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CLDN9 (ARP33617_T100) antibody is Catalog # AAP33617 (Previous Catalog # AAPP04673)
Datasheets/ManualsPrintable datasheet for anti-CLDN9 (ARP33617_T100) antibody
Target ReferenceKatoh,M. and Katoh,M., (2003) Int. J. Mol. Med. 11 (6), 683-689
Publications

Abuazza, G. et al. Claudins 6, 9, and 13 are developmentally expressed renal tight junction proteins. Am. J. Physiol. Renal Physiol. 291, F1132-41 (2006). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 16774906

Carrozzino, F., Pugnale, P., Féraille, E. & Montesano, R. Inhibition of basal p38 or JNK activity enhances epithelial barrier function through differential modulation of claudin expression. Am. J. Physiol. Cell Physiol. 297, C775-87 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 19605737

Gene SymbolCLDN9
Official Gene Full NameClaudin 9
NCBI Gene Id9080
Protein NameClaudin-9
Description of TargetCLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Swissprot IdO95484
Protein Accession #NP_066192
Nucleotide Accession #NM_020982
Protein Size (# AA)217
Molecular Weight24kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CLDN9.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CLDN9.
Write Your Own Review
You're reviewing:CLDN9 Antibody - C-terminal region (ARP33617_T100)
Your Rating
Free Microscope
Aviva HIS tag Deal
Aviva Validation Data
Assay Development