CLDN9 Antibody - C-terminal region (ARP33617_T100)

Catalog#: ARP33617_T100
Domestic: within 1-2 days delivery International: 1-2 days

Human HepG2

Size:	100 ul
Price:	$249.00
Availability: In Stock
Qty:
Request Bulk Order Quote

Aviva's Satisfaction Guarantee

Conjugation Options

ARP33617_T100-FITC Conjugated

ARP33617_T100-HRP Conjugated

ARP33617_T100-Biotin Conjugated

Tested Species Reactivity:: Human
Predicted Species Reactivity:: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:: Polyclonal
Host:: Rabbit
Application:: WB
Reconstitution and Storage:: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:: CLDN9
Official Gene Full Name:: Claudin 9
NCBI Gene Id:: 9080
Protein Name:: Claudin-9
Swissprot Id:: O95484
Protein Accession #:: NP_066192
Nucleotide Accession #:: NM_020982
Replacement Item:: This antibody may replace item sc-111499 from Santa Cruz Biotechnology.
Description of Target:: CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Protein Size (# AA):: 217
Molecular Weight:: 24kDa
Purification:: Protein A purified
Tissue Tool:: Find tissues and cell lines supported by DNA array analysis to express CLDN9.
RNA Seq:: Find tissues and cell lines supported by RNA-seq analysis to express CLDN9.
Immunogen:: The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN9
Predicted Homology Based on Immunogen Sequence:: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:: Anti-CLDN9 (ARP33617_T100)
Peptide Sequence:: Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
Concentration:: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:: For anti-CLDN9 (ARP33617_T100) antibody is Catalog # AAP33617 (Previous Catalog # AAPP04673)
Datasheets/Manuals:: Printable datasheet for anti-CLDN9 (ARP33617_T100) antibody

Target Reference:

Katoh,M. and Katoh,M., (2003) Int. J. Mol. Med. 11 (6), 683-689

Publications:

Abuazza, G. et al. Claudins 6, 9, and 13 are developmentally expressed renal tight junction proteins. Am. J. Physiol. Renal Physiol. 291, F1132-41 (2006). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 16774906

Carrozzino, F., Pugnale, P., FÃ©raille, E. & Montesano, R. Inhibition of basal p38 or JNK activity enhances epithelial barrier function through differential modulation of claudin expression. Am. J. Physiol. Cell Physiol. 297, C775-87 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 19605737