CLDN9 Antibody - C-terminal region (ARP33617_T100)

Size:100 ul

Human HepG2

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-111499 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN9
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Complete computational species homology data: Anti-CLDN9 (ARP33617_T100)
• Peptide Sequence: Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-CLDN9 (ARP33617_T100) antibody is Catalog # AAP33617 (Previous Catalog # AAPP04673)
• Datasheets/Manuals: Printable datasheet for anti-CLDN9 (ARP33617_T100) antibody
• Target Reference: Katoh,M. and Katoh,M., (2003) Int. J. Mol. Med. 11 (6), 683-689
• Publications:

  Abuazza, G. et al. Claudins 6, 9, and 13 are developmentally expressed renal tight junction proteins. Am. J. Physiol. Renal Physiol. 291, F1132-41 (2006). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 16774906

  Carrozzino, F., Pugnale, P., Féraille, E. & Montesano, R. Inhibition of basal p38 or JNK activity enhances epithelial barrier function through differential modulation of claudin expression. Am. J. Physiol. Cell Physiol. 297, C775-87 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 19605737

Target Info

• Gene Symbol: CLDN9
• Official Gene Full Name: Claudin 9
• NCBI Gene Id: 9080
• Protein Name: Claudin-9
• Description of Target: CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
• Swissprot Id: O95484
• Protein Accession #: NP_066192
• Nucleotide Accession #: NM_020982
• Protein Size (# AA): 217
• Molecular Weight: 24kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express CLDN9.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express CLDN9.