- Gene Symbol:
- CLDN9
- NCBI Gene Id:
- 9080
- Official Gene Full Name:
- Claudin 9
- Protein Name:
- Claudin-9
- Swissprot Id:
- O95484
- Protein Accession #:
- NP_066192
- Nucleotide Accession #:
- NM_020982
- Replacement Item:
- This antibody may replace item sc-111499 from Santa Cruz Biotechnology.
- Description of Target:
- CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
- Protein Size (# AA):
- 217
- Molecular Weight:
- 24kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Protein A purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express CLDN9.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express CLDN9.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN9
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
- Complete computational species homology data:
- Anti-CLDN9 (ARP33617_T100)
- Peptide Sequence:
- Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-CLDN9 (ARP33617_T100) antibody is Catalog # AAP33617 (Previous Catalog # AAPP04673)
- Datasheets/Manuals:
- Printable datasheet for anti-CLDN9 (ARP33617_T100) antibody
- Target Reference:
- Katoh,M. and Katoh,M., (2003) Int. J. Mol. Med. 11 (6), 683-689
- Publications:
Abuazza, G. et al. Claudins 6, 9, and 13 are developmentally expressed renal tight junction proteins. Am. J. Physiol. Renal Physiol. 291, F1132-41 (2006). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 16774906
Carrozzino, F., Pugnale, P., Féraille, E. & Montesano, R. Inhibition of basal p38 or JNK activity enhances epithelial barrier function through differential modulation of claudin expression. Am. J. Physiol. Cell Physiol. 297, C775-87 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 19605737
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
