Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CLDN9 Antibody - C-terminal region (ARP33617_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33617_T100-FITC Conjugated

ARP33617_T100-HRP Conjugated

ARP33617_T100-Biotin Conjugated

Gene Symbol:
CLDN9
Official Gene Full Name:
Claudin 9
NCBI Gene Id:
9080
Protein Name:
Claudin-9
Swissprot Id:
O95484
Protein Accession #:
NP_066192
Nucleotide Accession #:
NM_020982
Replacement Item:
This antibody may replace item sc-111499 from Santa Cruz Biotechnology.
Description of Target:
CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Protein Size (# AA):
217
Molecular Weight:
24kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLDN9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLDN9.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN9
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-CLDN9 (ARP33617_T100)
Peptide Sequence:
Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CLDN9 (ARP33617_T100) antibody is Catalog # AAP33617 (Previous Catalog # AAPP04673)
Datasheets/Manuals:
Printable datasheet for anti-CLDN9 (ARP33617_T100) antibody
Target Reference:
Katoh,M. and Katoh,M., (2003) Int. J. Mol. Med. 11 (6), 683-689
Publications:

Abuazza, G. et al. Claudins 6, 9, and 13 are developmentally expressed renal tight junction proteins. Am. J. Physiol. Renal Physiol. 291, F1132-41 (2006). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 16774906

Carrozzino, F., Pugnale, P., Féraille, E. & Montesano, R. Inhibition of basal p38 or JNK activity enhances epithelial barrier function through differential modulation of claudin expression. Am. J. Physiol. Cell Physiol. 297, C775-87 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 19605737

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...