Search Antibody, Protein, and ELISA Kit Solutions

CLDN5 Antibody - C-terminal region (ARP33627_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP33627_P050-FITC Conjugated

ARP33627_P050-HRP Conjugated

ARP33627_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-114920 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN5
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-CLDN5 (ARP33627_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CLDN5 (ARP33627_P050) antibody is Catalog # AAP33627 (Previous Catalog # AAPP04683)
Datasheets/Manuals:
Printable datasheet for anti-CLDN5 (ARP33627_P050) antibody
Target Reference:
Fontijn,R.D., Am. J. Physiol. Heart Circ. Physiol. 294 (2), H891-H900 (2008)
Publications:

Yang, R; Liu, W; Miao, L; Yang, X; Fu, J; Dou, B; Cai, A; Zong, X; Tan, C; Chen, H; Wang, X; Induction of VEGFA and Snail-1 by meningitic Escherichia coli mediates disruption of the blood-brain barrier. 7, 63839-63855 (2016). WB, Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat 27588479

Gene Symbol:
CLDN5
Official Gene Full Name:
Claudin 5
Alias Symbols:
AWAL, BEC1, CPETRL1, TMVCF
NCBI Gene Id:
7122
Protein Name:
Claudin-5
Description of Target:
CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
O00501
Protein Accession #:
NP_003268
Nucleotide Accession #:
NM_003277
Protein Size (# AA):
218
Molecular Weight:
23kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLDN5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLDN5.
Protein Interactions:
UBC; MPDZ; CLDN3; CLDN5; TJP1; CLDN1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...