Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP33627_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33627_P050-FITC Conjugated

ARP33627_P050-HRP Conjugated

ARP33627_P050-Biotin Conjugated

CLDN5 Antibody - C-terminal region (ARP33627_P050)

Catalog#: ARP33627_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-114920 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CLDN5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology dataAnti-CLDN5 (ARP33627_P050)
Peptide SequenceSynthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CLDN5 (ARP33627_P050) antibody is Catalog # AAP33627 (Previous Catalog # AAPP04683)
Datasheets/ManualsPrintable datasheet for anti-CLDN5 (ARP33627_P050) antibody
Target ReferenceFontijn,R.D., Am. J. Physiol. Heart Circ. Physiol. 294 (2), H891-H900 (2008)
Publications

Yang, R; Liu, W; Miao, L; Yang, X; Fu, J; Dou, B; Cai, A; Zong, X; Tan, C; Chen, H; Wang, X; Induction of VEGFA and Snail-1 by meningitic Escherichia coli mediates disruption of the blood-brain barrier. 7, 63839-63855 (2016). WB, Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat 27588479

Gene SymbolCLDN5
Official Gene Full NameClaudin 5
Alias SymbolsAWAL, BEC1, CPETRL1, TMVCF
NCBI Gene Id7122
Protein NameClaudin-5
Description of TargetCLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdO00501
Protein Accession #NP_003268
Nucleotide Accession #NM_003277
Protein Size (# AA)218
Molecular Weight23kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CLDN5.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CLDN5.
Protein InteractionsUBC; MPDZ; CLDN3; CLDN5; TJP1; CLDN1;
Write Your Own Review
You're reviewing:CLDN5 Antibody - C-terminal region (ARP33627_P050)
Your Rating
Aviva HIS tag Deal
Aviva Travel Grant
Aviva ChIP Antibodies
Aviva Live Chat