Search Antibody, Protein, and ELISA Kit Solutions

CLDN5 Antibody - C-terminal region (ARP33627_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33627_P050-FITC Conjugated

ARP33627_P050-HRP Conjugated

ARP33627_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Claudin 5
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-114920 from Santa Cruz Biotechnology.
Description of Target:
CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLDN5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLDN5.
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN5
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-CLDN5 (ARP33627_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CLDN5 (ARP33627_P050) antibody is Catalog # AAP33627 (Previous Catalog # AAPP04683)
Printable datasheet for anti-CLDN5 (ARP33627_P050) antibody
Target Reference:
Fontijn,R.D., Am. J. Physiol. Heart Circ. Physiol. 294 (2), H891-H900 (2008)

Yang, R; Liu, W; Miao, L; Yang, X; Fu, J; Dou, B; Cai, A; Zong, X; Tan, C; Chen, H; Wang, X; Induction of VEGFA and Snail-1 by meningitic Escherichia coli mediates disruption of the blood-brain barrier. 7, 63839-63855 (2016). WB, Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat 27588479

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...