- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
CLDN16 Antibody - C-terminal region : HRP (ARP33632_P050-HRP)
Datasheets/Manuals | Printable datasheet for anti-CLDN16 (ARP33632_P050-HRP) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
---|---|
Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | HRP: Horseradish Peroxidase |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN16 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86% |
Peptide Sequence | Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-CLDN16 (ARP33632_P050-HRP) antibody is Catalog # AAP33632 (Previous Catalog # AAPP04688) |
Reference | Muller,D., et al., (2003) Am. J. Hum. Genet. 73 (6), 1293-1301 |
Publications | Wang, F. E. et al. MicroRNA-204/211 alters epithelial physiology. FASEB J. 24, 1552-71 (2010). WB, Human, Horse, Rabbit, Pig, Rat, Dog, Mouse, Bovine 20056717 Peng, S., Rao, V. S., Adelman, R. A. & Rizzolo, L. J. Claudin-19 and the barrier properties of the human retinal pigment epithelium. Invest. Ophthalmol. Vis. Sci. 52, 1392-403 (2011). WB, Human, Horse, Rabbit, Pig, Rat, Dog, Mouse, Bovine 21071746 |
Gene Symbol | CLDN16 |
---|---|
Gene Full Name | Claudin 16 |
Alias Symbols | HOMG3, PCLN1 |
NCBI Gene Id | 10686 |
Protein Name | Claudin-16 |
Description of Target | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in the corresponding gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure.Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | Q9Y5I7 |
Protein Accession # | NP_006571 |
Nucleotide Accession # | NM_006580 |
Protein Size (# AA) | 305 |
Molecular Weight | 34kDa |
Protein Interactions | APP; TJP1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "CLDN16 Antibody - C-terminal region : HRP (ARP33632_P050-HRP)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".
-
How long will it take to receive "CLDN16 Antibody - C-terminal region : HRP (ARP33632_P050-HRP)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "CLDN16 Antibody - C-terminal region : HRP (ARP33632_P050-HRP)" provided in?
This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CLDN16 Antibody - C-terminal region : HRP (ARP33632_P050-HRP)"?
This target may also be called "HOMG3, PCLN1" in publications.
-
What is the shipping cost for "CLDN16 Antibody - C-terminal region : HRP (ARP33632_P050-HRP)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "CLDN16 Antibody - C-terminal region : HRP (ARP33632_P050-HRP)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "CLDN16 Antibody - C-terminal region : HRP (ARP33632_P050-HRP)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "34kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "CLDN16 Antibody - C-terminal region : HRP (ARP33632_P050-HRP)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CLDN16"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CLDN16"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CLDN16"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CLDN16"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CLDN16"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CLDN16"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.