Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP33632_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33632_P050-FITC Conjugated

ARP33632_P050-HRP Conjugated

ARP33632_P050-Biotin Conjugated

CLDN16 Antibody - C-terminal region (ARP33632_P050)

Catalog#: ARP33632_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN16
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%
Complete computational species homology data Anti-CLDN16 (ARP33632_P050)
Peptide Sequence Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CLDN16 (ARP33632_P050) antibody is Catalog # AAP33632 (Previous Catalog # AAPP04688)
Datasheets/Manuals Printable datasheet for anti-CLDN16 (ARP33632_P050) antibody
Target Reference Muller,D., et al., (2003) Am. J. Hum. Genet. 73 (6), 1293-1301
Publications

Peng, S., Rao, V. S., Adelman, R. A. & Rizzolo, L. J. Claudin-19 and the barrier properties of the human retinal pigment epithelium. Invest. Ophthalmol. Vis. Sci. 52, 1392-403 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 21071746

Wang, F. E. et al. MicroRNA-204/211 alters epithelial physiology. FASEB J. 24, 1552-71 (2010). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 20056717

Gene Symbol CLDN16
Official Gene Full Name Claudin 16
Alias Symbols HOMG3, PCLN1
NCBI Gene Id 10686
Protein Name Claudin-16
Description of Target Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in the corresponding gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure.Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q9Y5I7
Protein Accession # NP_006571
Nucleotide Accession # NM_006580
Protein Size (# AA) 305
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CLDN16.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CLDN16.
Protein Interactions APP; TJP1;
  1. What is the species homology for "CLDN16 Antibody - C-terminal region (ARP33632_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "CLDN16 Antibody - C-terminal region (ARP33632_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CLDN16 Antibody - C-terminal region (ARP33632_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CLDN16 Antibody - C-terminal region (ARP33632_P050)"?

    This target may also be called "HOMG3, PCLN1" in publications.

  5. What is the shipping cost for "CLDN16 Antibody - C-terminal region (ARP33632_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CLDN16 Antibody - C-terminal region (ARP33632_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CLDN16 Antibody - C-terminal region (ARP33632_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CLDN16 Antibody - C-terminal region (ARP33632_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CLDN16"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CLDN16"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CLDN16"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CLDN16"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CLDN16"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CLDN16"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CLDN16 Antibody - C-terminal region (ARP33632_P050)
Your Rating
We found other products you might like!