Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP33632_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33632_P050-FITC Conjugated

ARP33632_P050-HRP Conjugated

ARP33632_P050-Biotin Conjugated

CLDN16 Antibody - C-terminal region (ARP33632_P050)

Catalog#: ARP33632_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CLDN16
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%
Complete computational species homology dataAnti-CLDN16 (ARP33632_P050)
Peptide SequenceSynthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CLDN16 (ARP33632_P050) antibody is Catalog # AAP33632 (Previous Catalog # AAPP04688)
Datasheets/ManualsPrintable datasheet for anti-CLDN16 (ARP33632_P050) antibody
Target ReferenceMuller,D., et al., (2003) Am. J. Hum. Genet. 73 (6), 1293-1301
Publications

Peng, S., Rao, V. S., Adelman, R. A. & Rizzolo, L. J. Claudin-19 and the barrier properties of the human retinal pigment epithelium. Invest. Ophthalmol. Vis. Sci. 52, 1392-403 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 21071746

Wang, F. E. et al. MicroRNA-204/211 alters epithelial physiology. FASEB J. 24, 1552-71 (2010). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 20056717

Gene SymbolCLDN16
Official Gene Full NameClaudin 16
Alias SymbolsHOMG3, PCLN1
NCBI Gene Id10686
Protein NameClaudin-16
Description of TargetTight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in the corresponding gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure.Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdQ9Y5I7
Protein Accession #NP_006571
Nucleotide Accession #NM_006580
Protein Size (# AA)305
Molecular Weight34kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CLDN16.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CLDN16.
Protein InteractionsAPP; TJP1;
Write Your Own Review
You're reviewing:CLDN16 Antibody - C-terminal region (ARP33632_P050)
Your Rating
Aviva Validation Data
Aviva HIS tag Deal
Aviva Tissue Tool
Assay Development