Search Antibody, Protein, and ELISA Kit Solutions

CLDN16 Antibody - C-terminal region (ARP33632_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33632_P050-FITC Conjugated

ARP33632_P050-HRP Conjugated

ARP33632_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Claudin 16
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in the corresponding gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure.Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLDN16.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLDN16.
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN16
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%
Complete computational species homology data:
Anti-CLDN16 (ARP33632_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CLDN16 (ARP33632_P050) antibody is Catalog # AAP33632 (Previous Catalog # AAPP04688)
Printable datasheet for anti-CLDN16 (ARP33632_P050) antibody
Target Reference:
Muller,D., et al., (2003) Am. J. Hum. Genet. 73 (6), 1293-1301

Peng, S., Rao, V. S., Adelman, R. A. & Rizzolo, L. J. Claudin-19 and the barrier properties of the human retinal pigment epithelium. Invest. Ophthalmol. Vis. Sci. 52, 1392-403 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 21071746

Wang, F. E. et al. MicroRNA-204/211 alters epithelial physiology. FASEB J. 24, 1552-71 (2010). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 20056717

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...