- Tested Species Reactivity:
- Human
- Predicted Species Reactivity:
- Human
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- CLCN4
- NCBI Gene Id:
- 1183
- Swissprot Id:
- P51793
- Protein Accession #:
- NP_001821
- Alias Symbols:
- CLCN4,
- Replacement Item:
- This antibody may replace item sc-16435 from Santa Cruz Biotechnology.
- Description of Target:
- The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 4 has an evolutionary conserved CpG island and is conserved in both mouse and hamster. This gene is mapped in close proximity to APXL (Apical protein Xenopus laevis-like) and OA1 (Ocular albinism type I), which are both located on the human X chromosome at band p22.3. The physiological role of chloride channel 4 remains unknown but may contribute to the pathogenesis of neuronal disorders. Alternate splicing results in two transcript variants that encode different proteins.
- Protein Size (# AA):
- 760
- Molecular Weight:
- 83kDa
- Purification:
- Affinity Purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express CLCN4.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express CLCN4.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLCN4
- Peptide Sequence:
- Synthetic peptide located within the following region: LMDFLDEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEFIK
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-CLCN4 (ARP73792_P050) antibody is Catalog # AAP73792
- Datasheets/Manuals:
- Printable datasheet for anti-CLCN4 (ARP73792_P050) antibody
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
