CLCN4 Antibody - N-terminal region (ARP73792_P050)

Catalog#: ARP73792_P050

• Size: 100 ul

• Gene Symbol: CLCN4
• NCBI Gene Id: 1183
• Swissprot Id: P51793
• Protein Accession #: NP_001821
• Alias Symbols: CLCN4,
• Replacement Item: This antibody may replace item sc-16435 from Santa Cruz Biotechnology.
• Description of Target: The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 4 has an evolutionary conserved CpG island and is conserved in both mouse and hamster. This gene is mapped in close proximity to APXL (Apical protein Xenopus laevis-like) and OA1 (Ocular albinism type I), which are both located on the human X chromosome at band p22.3. The physiological role of chloride channel 4 remains unknown but may contribute to the pathogenesis of neuronal disorders. Alternate splicing results in two transcript variants that encode different proteins.
• Protein Size (# AA): 760
• Molecular Weight: 83kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity Purified
• Application: WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express CLCN4.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLCN4
• Predicted Species Reactivity: Human
• Tested Species Reactivity: Human
• Peptide Sequence: Synthetic peptide located within the following region: LMDFLDEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEFIK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-CLCN4 (ARP73792_P050) antibody is Catalog # AAP73792

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.