Search Antibody, Protein, and ELISA Kit Solutions

CLCN4 Antibody - N-terminal region (ARP73792_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73792_P050-FITC Conjugated

ARP73792_P050-HRP Conjugated

ARP73792_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CLCN4
NCBI Gene Id:
1183
Swissprot Id:
P51793
Protein Accession #:
NP_001821
Alias Symbols:
CLCN4,
Replacement Item:
This antibody may replace item sc-16435 from Santa Cruz Biotechnology.
Description of Target:
The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 4 has an evolutionary conserved CpG island and is conserved in both mouse and hamster. This gene is mapped in close proximity to APXL (Apical protein Xenopus laevis-like) and OA1 (Ocular albinism type I), which are both located on the human X chromosome at band p22.3. The physiological role of chloride channel 4 remains unknown but may contribute to the pathogenesis of neuronal disorders. Alternate splicing results in two transcript variants that encode different proteins.
Protein Size (# AA):
760
Molecular Weight:
83kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLCN4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLCN4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLCN4
Peptide Sequence:
Synthetic peptide located within the following region: LMDFLDEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEFIK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CLCN4 (ARP73792_P050) antibody is Catalog # AAP73792
Datasheets/Manuals:
Printable datasheet for anti-CLCN4 (ARP73792_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...