Search Antibody, Protein, and ELISA Kit Solutions

CLCN3 Antibody - C-terminal region : HRP (ARP35504_T100-HRP)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35504_T100 Unconjugated

ARP35504_T100-FITC Conjugated

ARP35504_T100-Biotin Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
HRP
Application:
IHC, WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item:
This antibody may replace item sc-133466 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of human CLCN3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 91%; Zebrafish: 100%
Complete computational species homology data:
Anti-CLCN3 (ARP35504_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-CLCN3 (ARP35504_T100-HRP) antibody is Catalog # AAP35504 (Previous Catalog # AAPP06744)
Datasheets/Manuals:
Printable datasheet for anti-CLCN3 (ARP35504_T100-HRP) antibody
Target Reference:
Salazar,G., et al., (2004) J. Biol. Chem. 279 (24), 25430-25439
Publications:

Jensen, V. K. et al. A quantitative assay for lysosomal acidification rates in human osteoclasts. Assay Drug Dev. Technol. 9, 157-64 (2011). WB, Zebrafish, Human, Dog, Mouse, Bovine, Pig, Horse, Rabbit, Guinea pig, Rat, Sheep 21050068

Gene Symbol:
CLCN3
Official Gene Full Name:
Chloride channel, voltage-sensitive 3
Alias Symbols:
CLC3, ClC-3
NCBI Gene Id:
1182
Protein Name:
H(+)/Cl(-) exchange transporter 3
Description of Target:
CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator).
Swissprot Id:
P51790
Protein Accession #:
NP_776297
Nucleotide Accession #:
NM_173872
Protein Size (# AA):
866
Molecular Weight:
95kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLCN3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLCN3.
Protein Interactions:
GOPC; SLC9A3R1; PDZK1; CLCN3; CFTR;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...