Search Antibody, Protein, and ELISA Kit Solutions

CLCN3 Antibody - C-terminal region (ARP35504_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35504_T100-FITC Conjugated

ARP35504_T100-HRP Conjugated

ARP35504_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Chloride channel, voltage-sensitive 3
NCBI Gene Id:
Protein Name:
H(+)/Cl(-) exchange transporter 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CLC3, ClC-3
Replacement Item:
This antibody may replace item sc-133466 from Santa Cruz Biotechnology.
Description of Target:
CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator).
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLCN3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLCN3.
The immunogen is a synthetic peptide directed towards the C-terminal region of human CLCN3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 91%; Zebrafish: 100%
Complete computational species homology data:
Anti-CLCN3 (ARP35504_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CLCN3 (ARP35504_T100) antibody is Catalog # AAP35504 (Previous Catalog # AAPP06744)
Printable datasheet for anti-CLCN3 (ARP35504_T100) antibody
Target Reference:
Salazar,G., et al., (2004) J. Biol. Chem. 279 (24), 25430-25439

Jensen, V. K. et al. A quantitative assay for lysosomal acidification rates in human osteoclasts. Assay Drug Dev. Technol. 9, 157-64 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 21050068

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...