Size:100 ul
$249.00
In stock
SKU
ARP35504_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35504_T100-FITC Conjugated

ARP35504_T100-HRP Conjugated

ARP35504_T100-Biotin Conjugated

CLCN3 Antibody - C-terminal region (ARP35504_T100)

Catalog#: ARP35504_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133466 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human CLCN3
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 91%; Zebrafish: 100%
Complete computational species homology data Anti-CLCN3 (ARP35504_T100)
Peptide Sequence Synthetic peptide located within the following region: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CLCN3 (ARP35504_T100) antibody is Catalog # AAP35504 (Previous Catalog # AAPP06744)
Datasheets/Manuals Printable datasheet for anti-CLCN3 (ARP35504_T100) antibody
Target Reference Salazar,G., et al., (2004) J. Biol. Chem. 279 (24), 25430-25439
Publications

Jensen, V. K. et al. A quantitative assay for lysosomal acidification rates in human osteoclasts. Assay Drug Dev. Technol. 9, 157-64 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 21050068

Gene Symbol CLCN3
Official Gene Full Name Chloride channel, voltage-sensitive 3
Alias Symbols CLC3, ClC-3
NCBI Gene Id 1182
Protein Name H(+)/Cl(-) exchange transporter 3
Description of Target CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator).
Swissprot Id P51790
Protein Accession # NP_776297
Nucleotide Accession # NM_173872
Protein Size (# AA) 866
Molecular Weight 95kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CLCN3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CLCN3.
Protein Interactions GOPC; SLC9A3R1; PDZK1; CLCN3; CFTR;
Write Your Own Review
You're reviewing:CLCN3 Antibody - C-terminal region (ARP35504_T100)
Your Rating