Search Antibody, Protein, and ELISA Kit Solutions

CKMT2 Antibody - N-terminal region (ARP41478_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41478_T100-FITC Conjugated

ARP41478_T100-HRP Conjugated

ARP41478_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Creatine kinase, mitochondrial 2 (sarcomeric)
NCBI Gene Id:
Protein Name:
Creatine kinase S-type, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase.Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CKMT2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CKMT2.
The immunogen is a synthetic peptide directed towards the N terminal region of human CKMT2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-CKMT2 (ARP41478_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CKMT2 (ARP41478_T100) antibody is Catalog # AAP41478 (Previous Catalog # AAPS09312)
Printable datasheet for anti-CKMT2 (ARP41478_T100) antibody
Target Reference:
Guerrero,K., Am. J. Physiol. Regul. Integr. Comp. Physiol. 289 (4), R1144-R1154

Choudhuri, A., Maitra, U. & Evans, T. Translation initiation factor eif3h targets specific transcripts to polysomes during embryogenesis. Proc. Natl. Acad. Sci. U. S. A. 110, 9818-23 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23716667

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...