Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
SKU
ARP41478_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41478_T100-FITC Conjugated

ARP41478_T100-HRP Conjugated

ARP41478_T100-Biotin Conjugated

CKMT2 Antibody - N-terminal region (ARP41478_T100)

Catalog#: ARP41478_T100
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CKMT2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-CKMT2 (ARP41478_T100)
Peptide Sequence Synthetic peptide located within the following region: GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CKMT2 (ARP41478_T100) antibody is Catalog # AAP41478 (Previous Catalog # AAPS09312)
Datasheets/Manuals Printable datasheet for anti-CKMT2 (ARP41478_T100) antibody
Target Reference Guerrero,K., Am. J. Physiol. Regul. Integr. Comp. Physiol. 289 (4), R1144-R1154
Publications

Choudhuri, A., Maitra, U. & Evans, T. Translation initiation factor eif3h targets specific transcripts to polysomes during embryogenesis. Proc. Natl. Acad. Sci. U. S. A. 110, 9818-23 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23716667

Gene Symbol CKMT2
Official Gene Full Name Creatine kinase, mitochondrial 2 (sarcomeric)
Alias Symbols SMTCK
NCBI Gene Id 1160
Protein Name Creatine kinase S-type, mitochondrial
Description of Target Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase.Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis.
Swissprot Id P17540
Protein Accession # NP_001816
Nucleotide Accession # NM_001825
Protein Size (# AA) 419
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CKMT2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CKMT2.
Protein Interactions UBC; ABHD6; TMED9; ELN; PSMD4; LRIF1; OLFML3; UNC119; CKMT2;
Write Your Own Review
You're reviewing:CKMT2 Antibody - N-terminal region (ARP41478_T100)
Your Rating