SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP47947_P050
Price: $0.00
SKU
ARP47947_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CKLF (ARP47947_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CKLF
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CKLF (ARP47947_P050) antibody is Catalog # AAP47947 (Previous Catalog # AAPS19310)
Sample Type Confirmation

CKLF is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceWang,Y., (2008) Int. J. Biochem. Cell Biol. 40 (5), 909-919
Gene SymbolCKLF
Gene Full NameChemokine-like factor
Alias SymbolsC32, CKLF1, CKLF2, CKLF3, CKLF4, UCK-1, HSPC224
NCBI Gene Id51192
Protein NameChemokine-like factor
Description of TargetCKLF is a cytokine. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle.The product of this gene is a cytokine. Cytokines are small proteins that have an essential role in the immune and inflammatory responses. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. The protein encoded by this gene is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle. Alternatively spliced transcript variants encoding different isoforms have been identified.
Uniprot IDQ9UBR5
Protein Accession #NP_001035228
Nucleotide Accession #NM_001040138
Protein Size (# AA)113
Molecular Weight13kDa
Protein InteractionsUBC;
  1. What is the species homology for "CKLF Antibody - N-terminal region (ARP47947_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CKLF Antibody - N-terminal region (ARP47947_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CKLF Antibody - N-terminal region (ARP47947_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CKLF Antibody - N-terminal region (ARP47947_P050)"?

    This target may also be called "C32, CKLF1, CKLF2, CKLF3, CKLF4, UCK-1, HSPC224" in publications.

  5. What is the shipping cost for "CKLF Antibody - N-terminal region (ARP47947_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CKLF Antibody - N-terminal region (ARP47947_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CKLF Antibody - N-terminal region (ARP47947_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "13kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CKLF Antibody - N-terminal region (ARP47947_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CKLF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CKLF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CKLF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CKLF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CKLF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CKLF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CKLF Antibody - N-terminal region (ARP47947_P050)
Your Rating