Cish Antibody - N-terminal region (ARP52798_P050)

Catalog No: ARP52798_P050

WB Suggested Anti-Cish Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Heart

Host: Rabbit
Target Name: CISH
Sample Tissue: Mouse Mouse Kidney
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Cish (ARP52798_P050) antibody is Catalog # AAP52798 (Previous Catalog # AAPP43311)

Target Info

• Gene Symbol: Cish
• Gene Full Name: Cytokine inducible SH2-containing protein
• Alias Symbols: C, CI, Cis, F17, F23, CIS1, SOCS, CIS-1
• NCBI Gene Id: 12700
• Protein Name: Cytokine-inducible SH2-containing protein
• Description of Target: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. CIS is involved in the negative regulation of cytokines that signal through the JAK-STAT5 pathway such as erythropoietin, prolactin and interleukin 3 (IL3) receptor. Inhibits STAT5 trans-activation by suppressing its tyrosine phosphorylation. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
• Uniprot ID: Q62225
• Protein Accession #: NP_034025
• Nucleotide Accession #: NM_009895
• Protein Size (# AA): 257
• Molecular Weight: 28kDa
• Protein Interactions: GHR; Socs2; Lepr; Epor; Prkcq; Prkcb; Prkca; Ubc; Abl1; Cul5; TCEB2; TCEB1; Stat5a;