Protein on Demand™ Circumsporozoite Protein Recombinant Protein (Plasmodium falciparum) (OPCA70489)

Catalog No: OPCA70489

Product Info

• Predicted Species Reactivity: Plasmodium falciparum
• Product Format: Lyophilized 10mM Tris-HCl, 1mM EDTA, 6% Trehalose (pH 8.0)
• Application: WB, ELISA
• Additional Information: For Research Use Only.
  Sterile filtering available upon request.
  Low endotoxin available upon request.
• Reconstitution and Storage: Briefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20°C/-80°C. Our in house default final concentration of glycerol is 50% for reference. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: Partial Protein (336-412aa): KKIKNSISTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYENDIEKKICKMEKCSSVFNVVNSSIGLIMVLSFLFLN
• Tag: This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.

Target Info

• Protein Name: Circumsporozoite protein
• Description of Target: The cicrumsporozoite protein is the immunodominant surface antigen on the sporozoite (the infective stage of the malaria parasite that is transmitted from the mosquito to the vertebrate host).
• Uniprot ID: P02893
• Protein Size (# AA): 396
• Molecular Weight: 12 kDa