Search Antibody, Protein, and ELISA Kit Solutions

CIP2A Antibody - middle region (ARP87926_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
CIP2A
Official Gene Full Name:
cell proliferation regulating inhibitor of protein phosphatase 2A
NCBI Gene Id:
57650
Protein Name:
protein CIP2A
Swissprot Id:
Q8TCG1-2
Protein Accession #:
NP_065941.2
Nucleotide Accession #:
NM_020890.2
Alias Symbols:
p90, KIAA1524
Protein Size (# AA):
746
Molecular Weight:
85 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CIP2A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CIP2A.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human KIAA1524
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MDLLKNPKIADYLTRYEHFSSCLHQVLGLLNGKDPDSSSKVLELLLAFCS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CIP2A (ARP87926_P050) antibody is Catalog # AAP87926
Datasheets/Manuals:
Printable datasheet for anti-CIP2A (ARP87926_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...