CIITA Antibody - C-terminal region (ARP36830_P050)

Catalog No: ARP36830_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-C2TA Antibody Titration: 0.125ug/ml
ELISA Titer: 1:62500
Positive Control: NIH/3T3 cell lysate

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Dog
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse C2TA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Human: 79%; Mouse: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CIITA (ARP36830_P050) antibody is Catalog # AAP36830 (Previous Catalog # AAPP09903)
• Reference: Pennini,M.E., et al., (2006) J. Immunol. 176 (7), 4323-4330

Target Info

• Gene Symbol: CIITA
• Gene Full Name: class II transactivator
• Alias Symbols: C2t, C2ta, Gm9475, Mhc2ta, EG669998
• NCBI Gene Id: 12265
• Protein Name: MHC class II transactivator
• Description of Target: This gene encodes a member of the NOD-like receptor protein family. This protein acts as a transcriptional coactivator and component of the enhanceosome complex to stimulate transcription of MHC class II genes in the adaptive immune response. This protein may also regulate the transcription of MHC class I genes. Mutations in the human gene have been linked to a rare immunodeficiency, bare lymphocyte syndrome, and homozygous knockout mice exhibit many features of this disease. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Uniprot ID: Q3U2P0
• Protein Accession #: NP_031601
• Nucleotide Accession #: NM_007575
• Protein Size (# AA): 1078
• Molecular Weight: 119kDa
• Protein Interactions: Rfxank; Ssbp4; Ssbp3; Gmeb1; Cited4; Tcf3; Nfe2; Hoxa2; Ewsr1;