CIDEA Antibody - middle region (ARP81000_P050)

Catalog No: ARP81000_P050

Host: Rabbit
Target Name: CIDEA
Sample Tissue: Human HCT116 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CIDEA
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CIDEA (ARP81000_P050) antibody is Catalog # AAP81000

Target Info

• Gene Symbol: CIDEA
• Gene Full Name: cell death-inducing DFFA-like effector a
• Alias Symbols: CIDE-A
• NCBI Gene Id: 1149
• Protein Name: cell death activator CIDE-A
• Description of Target: This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Alternatively spliced transcripts have been identified.
• Uniprot ID: O60543
• Protein Accession #: NP_001270.1
• Nucleotide Accession #: NM_001279.3
• Protein Size (# AA): 219
• Molecular Weight: 24 kDa