Search Antibody, Protein, and ELISA Kit Solutions

CHSY1 Antibody - C-terminal region : FITC (ARP73930_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73930_P050 Unconjugated

ARP73930_P050-HRP Conjugated

ARP73930_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CHSY1
Official Gene Full Name:
chondroitin sulfate synthase 1
NCBI Gene Id:
22856
Protein Name:
chondroitin sulfate synthase 1
Swissprot Id:
Q86X52
Protein Accession #:
NP_055733
Alias Symbols:
CHSY, CSS1, TPBS, ChSy-1
Description of Target:
This gene encodes a member of the chondroitin N-acetylgalactosaminyltransferase family. These enzymes possess dual glucuronyltransferase and galactosaminyltransferase activity and play critical roles in the biosynthesis of chondroitin sulfate, a glycosaminoglycan involved in many biological processes including cell proliferation and morphogenesis. Decreased expression of this gene may play a role in colorectal cancer, and mutations in this gene are a cause of temtamy preaxial brachydactyly syndrome.
Protein Size (# AA):
802
Molecular Weight:
88kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHSY1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHSY1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CHSS1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: CDPNLDPKQYKMCLGSKASTYGSTQQLAEMWLEKNDPSYSKSSNNNGSVR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
ELAVL1;
Blocking Peptide:
For anti-CHSY1 (ARP73930_P050-FITC) antibody is Catalog # AAP73930
Datasheets/Manuals:
Printable datasheet for anti-CHSY1 (ARP73930_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...