CHSY1 Antibody - C-terminal region (ARP73930_P050)

Catalog No: ARP73930_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: CHSS1
Sample Type: 786-0 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CHSS1
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: CDPNLDPKQYKMCLGSKASTYGSTQQLAEMWLEKNDPSYSKSSNNNGSVR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CHSY1 (ARP73930_P050) antibody is Catalog # AAP73930

Target Info

• Gene Symbol: CHSY1
• Gene Full Name: chondroitin sulfate synthase 1
• Alias Symbols: CHSY, CSS1, TPBS, ChSy-1
• NCBI Gene Id: 22856
• Protein Name: chondroitin sulfate synthase 1
• Description of Target: This gene encodes a member of the chondroitin N-acetylgalactosaminyltransferase family. These enzymes possess dual glucuronyltransferase and galactosaminyltransferase activity and play critical roles in the biosynthesis of chondroitin sulfate, a glycosaminoglycan involved in many biological processes including cell proliferation and morphogenesis. Decreased expression of this gene may play a role in colorectal cancer, and mutations in this gene are a cause of temtamy preaxial brachydactyly syndrome.
• Uniprot ID: Q86X52
• Protein Accession #: NP_055733
• Protein Size (# AA): 802
• Molecular Weight: 88kDa
• Protein Interactions: ELAVL1;