Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CHST14 Antibody - middle region (ARP48994_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48994_P050-FITC Conjugated

ARP48994_P050-HRP Conjugated

ARP48994_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CHST14
Official Gene Full Name:
Carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14
NCBI Gene Id:
113189
Protein Name:
Carbohydrate sulfotransferase 14
Swissprot Id:
Q8NCH0
Protein Accession #:
AAH23653
Nucleotide Accession #:
Q8NCH0
Alias Symbols:
D4ST-1, D4ST1, HD4ST, HNK1ST, ATCS
Description of Target:
CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
Protein Size (# AA):
338
Molecular Weight:
35kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHST14.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHST14.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CHST14
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-CHST14 (ARP48994_P050)
Peptide Sequence:
Synthetic peptide located within the following region: REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBD;
Blocking Peptide:
For anti-CHST14 (ARP48994_P050) antibody is Catalog # AAP48994 (Previous Catalog # AAPY02145)
Datasheets/Manuals:
Printable datasheet for anti-CHST14 (ARP48994_P050) antibody
Publications:

Janecke, AR; Li, B; Boehm, M; Krabichler, B; Rohrbach, M; Müller, T; Fuchs, I; Golas, G; Katagiri, Y; Ziegler, SG; Gahl, WA; Wilnai, Y; Zoppi, N; Geller, HM; Giunta, C; Slavotinek, A; Steinmann, B; The phenotype of the musculocontractural type of Ehlers-Danlos syndrome due to CHST14 mutations. 170A, 103-15 (2016). WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat 26373698

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...