- Gene Symbol:
- CHST14
- NCBI Gene Id:
- 113189
- Official Gene Full Name:
- Carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14
- Protein Name:
- Carbohydrate sulfotransferase 14
- Swissprot Id:
- Q8NCH0
- Protein Accession #:
- AAH23653
- Nucleotide Accession #:
- Q8NCH0
- Alias Symbols:
- D4ST-1, D4ST1, HD4ST, HNK1ST, ATCS
- Description of Target:
- CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
- Protein Size (# AA):
- 338
- Molecular Weight:
- 35kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express CHST14.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express CHST14.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the middle region of human CHST14
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
- Complete computational species homology data:
- Anti-CHST14 (ARP48994_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- UBD;
- Blocking Peptide:
- For anti-CHST14 (ARP48994_P050) antibody is Catalog # AAP48994 (Previous Catalog # AAPY02145)
- Datasheets/Manuals:
- Printable datasheet for anti-CHST14 (ARP48994_P050) antibody
- Publications:
Janecke, AR; Li, B; Boehm, M; Krabichler, B; Rohrbach, M; Müller, T; Fuchs, I; Golas, G; Katagiri, Y; Ziegler, SG; Gahl, WA; Wilnai, Y; Zoppi, N; Geller, HM; Giunta, C; Slavotinek, A; Steinmann, B; The phenotype of the musculocontractural type of Ehlers-Danlos syndrome due to CHST14 mutations. 170A, 103-15 (2016). WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat 26373698
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
