CHST14 Antibody - middle region (ARP48994_P050)

Catalog#: ARP48994_P050

• Size: 100 ul

• Gene Symbol: CHST14
• Official Gene Full Name: Carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14
• NCBI Gene Id: 113189
• Protein Name: Carbohydrate sulfotransferase 14
• Swissprot Id: Q8NCH0
• Protein Accession #: AAH23653
• Nucleotide Accession #: Q8NCH0
• Alias Symbols: D4ST-1, D4ST1, HD4ST, HNK1ST, ATCS
• Description of Target: CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
• Protein Size (# AA): 338
• Molecular Weight: 35kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity Purified
• Application: WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express CHST14.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHST14
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
• Tested Species Reactivity: Human
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: UBD;
• Blocking Peptide: For anti-CHST14 (ARP48994_P050) antibody is Catalog # AAP48994 (Previous Catalog # AAPY02145)
• Publications:

  Janecke, AR; Li, B; Boehm, M; Krabichler, B; Rohrbach, M; Müller, T; Fuchs, I; Golas, G; Katagiri, Y; Ziegler, SG; Gahl, WA; Wilnai, Y; Zoppi, N; Geller, HM; Giunta, C; Slavotinek, A; Steinmann, B; The phenotype of the musculocontractural type of Ehlers-Danlos syndrome due to CHST14 mutations. 170A, 103-15 (2016). WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat 26373698

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: CHST14 antibody tested with Human Hepg2 Cells (ARP48994_P050)