Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48994_P050-FITC Conjugated

ARP48994_P050-HRP Conjugated

ARP48994_P050-Biotin Conjugated

CHST14 Antibody - middle region (ARP48994_P050)

Catalog#: ARP48994_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CHST14
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data Anti-CHST14 (ARP48994_P050)
Peptide Sequence Synthetic peptide located within the following region: REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CHST14 (ARP48994_P050) antibody is Catalog # AAP48994 (Previous Catalog # AAPY02145)
Datasheets/Manuals Printable datasheet for anti-CHST14 (ARP48994_P050) antibody

Janecke, AR; Li, B; Boehm, M; Krabichler, B; Rohrbach, M; Müller, T; Fuchs, I; Golas, G; Katagiri, Y; Ziegler, SG; Gahl, WA; Wilnai, Y; Zoppi, N; Geller, HM; Giunta, C; Slavotinek, A; Steinmann, B; The phenotype of the musculocontractural type of Ehlers-Danlos syndrome due to CHST14 mutations. 170A, 103-15 (2016). WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat 26373698

Gene Symbol CHST14
Official Gene Full Name Carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14
Alias Symbols D4ST-1, D4ST1, HD4ST, HNK1ST, ATCS
NCBI Gene Id 113189
Protein Name Carbohydrate sulfotransferase 14
Description of Target CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
Swissprot Id Q8NCH0
Protein Accession # AAH23653
Nucleotide Accession # Q8NCH0
Protein Size (# AA) 338
Molecular Weight 35kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CHST14.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CHST14.
Protein Interactions UBD;
  1. What is the species homology for "CHST14 Antibody - middle region (ARP48994_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat".

  2. How long will it take to receive "CHST14 Antibody - middle region (ARP48994_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CHST14 Antibody - middle region (ARP48994_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "CHST14 Antibody - middle region (ARP48994_P050)"?

    This target may also be called "D4ST-1, D4ST1, HD4ST, HNK1ST, ATCS" in publications.

  5. What is the shipping cost for "CHST14 Antibody - middle region (ARP48994_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CHST14 Antibody - middle region (ARP48994_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CHST14 Antibody - middle region (ARP48994_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CHST14 Antibody - middle region (ARP48994_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CHST14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CHST14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CHST14"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CHST14"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CHST14"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CHST14"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CHST14 Antibody - middle region (ARP48994_P050)
Your Rating
We found other products you might like!