Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP49073_P050
Price: $0.00
SKU
ARP49073_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CHST13 Antibody - C-terminal region (ARP49073_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-CHST13 (ARP49073_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CHST13
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 77%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: CHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CHST13 (ARP49073_P050) antibody is Catalog # AAP49073 (Previous Catalog # AAPY02245)
ReferenceKang,H.G., (2002) J. Biol. Chem. 277 (38), 34766-34772
Gene SymbolCHST13
Gene Full NameCarbohydrate (chondroitin 4) sulfotransferase 13
Alias SymbolsC4ST3
NCBI Gene Id166012
Protein NameCarbohydrate sulfotransferase 13
Description of TargetCHST13 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. It transfers sulfate to the C4 hydroxyl of beta1,4-linked GalNAc that is substituted with a beta-linked glucuronic acid at the C-3 hydroxyl. C4ST3 transfers sulfate to the C-4 hydroxyl of beta-1,4-linked GalNAc flanked by GlcUA residues in chondroitin (Kang et al., 2002 [PubMed 12080076]).[supplied by OMIM].
Uniprot IDQ8NET6
Protein Accession #NP_690849
Nucleotide Accession #NM_152889
Protein Size (# AA)341
Molecular Weight39kDa
  1. What is the species homology for "CHST13 Antibody - C-terminal region (ARP49073_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Guinea Pig".

  2. How long will it take to receive "CHST13 Antibody - C-terminal region (ARP49073_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CHST13 Antibody - C-terminal region (ARP49073_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CHST13 Antibody - C-terminal region (ARP49073_P050)"?

    This target may also be called "C4ST3" in publications.

  5. What is the shipping cost for "CHST13 Antibody - C-terminal region (ARP49073_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CHST13 Antibody - C-terminal region (ARP49073_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CHST13 Antibody - C-terminal region (ARP49073_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CHST13 Antibody - C-terminal region (ARP49073_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CHST13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CHST13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CHST13"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CHST13"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CHST13"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CHST13"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CHST13 Antibody - C-terminal region (ARP49073_P050)
Your Rating