SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45495_T100
Price: $0.00
SKU
ARP45495_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CHST1 (ARP45495_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CHST1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL
Concentration1.0 mg/ml
Blocking PeptideFor anti-CHST1 (ARP45495_T100) antibody is Catalog # AAP45495 (Previous Catalog # AAPP26560)
ReferenceYamada,T., Biochem. J. 384 (PT 3), 567-575 (2004)
Publications

Sulfation of O-glycans on Mucin-type Proteins From Serous Ovarian Epithelial Tumors. Mol Cell Proteomics. 20, 100150 (2021). 34555499

Description
Gene SymbolCHST1
Gene Full NameCarbohydrate (keratan sulfate Gal-6) sulfotransferase 1
Alias SymbolsC6ST, KSST, GST-1, KS6ST, KSGal6ST
NCBI Gene Id8534
Protein NameCarbohydrate sulfotransferase 1
Description of TargetCHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc structures is much higher than the corresponding desialylated substrate, and only internal Gal residues are sulfated. It may function in the sulfation of sialyl N-acetyllactosamine oligosaccharide chains attached to glycoproteins. It participates in biosynthesis of selectin ligands. Selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation.
Uniprot IDO43916
Protein Accession #NP_003645
Nucleotide Accession #NM_003654
Protein Size (# AA)411
Molecular Weight47kDa
Protein InteractionsNHP2L1; SFN;
  1. What is the species homology for "CHST1 Antibody - N-terminal region (ARP45495_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "CHST1 Antibody - N-terminal region (ARP45495_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CHST1 Antibody - N-terminal region (ARP45495_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CHST1 Antibody - N-terminal region (ARP45495_T100)"?

    This target may also be called "C6ST, KSST, GST-1, KS6ST, KSGal6ST" in publications.

  5. What is the shipping cost for "CHST1 Antibody - N-terminal region (ARP45495_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CHST1 Antibody - N-terminal region (ARP45495_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CHST1 Antibody - N-terminal region (ARP45495_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CHST1 Antibody - N-terminal region (ARP45495_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CHST1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CHST1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CHST1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CHST1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CHST1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CHST1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CHST1 Antibody - N-terminal region (ARP45495_T100)
Your Rating