CHRNG Recombinant Protein (Human) (OPCA03261)

Catalog No: OPCA03261

CHRNG Recombinant Protein (Human) (OPCA03261) in SDS-PAGE showing the molecular weight of approximately 27.46 kDa.

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Host: Human
• Reconstitution and Storage: -20°C or -80°C
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: RNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK
• Protein Sequence: RNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 23-240 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Cloning and sequence analysis of human genomic DNA encoding gamma subunit precursor of muscle acetylcholine receptor.Shibahara S., Kubo T., Perski H.J., Takahashi H., Noda M., Numa S.Eur. J. Biochem. 146:15-22(1985)

Target Info

• Gene Symbol: CHRNG
• Gene Full Name: cholinergic receptor nicotinic gamma subunit
• Alias Symbols: acetylcholine receptor subunit gamma;acetylcholine receptor, muscle, gamma subunit;acetylcholine receptor, nicotinic, gamma (muscle);ACHRG;cholinergic receptor, nicotinic gamma;cholinergic receptor, nicotinic, gamma (muscle);cholinergic receptor, nicotinic, gamma polypeptide.
• NCBI Gene Id: 1146
• Protein Name: Acetylcholine receptor subunit gamma
• Description of Target: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
• Uniprot ID: P07510
• Protein Accession #: NP_005190.4
  
• Nucleotide Accession #: NM_005199.4
• Protein Size (# AA): Recombinant
• Molecular Weight: 27.5 kDa