CHRNG Antibody - N-terminal region : FITC (AVARP13024_T100-FITC)

Catalog No: AVARP13024_T100-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNG
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CHRNG (AVARP13024_T100-FITC) antibody is Catalog # AAP30670

Target Info

• Reference: Arredondo,J., et al., (2005) Am. J. Pathol. 166 (2), 597-613
• Gene Symbol: CHRNG
• Gene Full Name: cholinergic receptor nicotinic gamma subunit
• Alias Symbols: ACHRG
• NCBI Gene Id: 1146
• Protein Name: Acetylcholine receptor subunit gamma
• Description of Target: The mammalian muscle-type acetylcholine receptor is a transmembrane pentameric glycoprotein with two alpha subunits, one beta, one delta, and one epsilon (in adult skeletal muscle) or gamma (in fetal and denervated muscle) subunit. This gene, which encodes the gamma subunit, is expressed prior to the thirty-third week of gestation in humans. The gamma subunit of the acetylcholine receptor plays a role in neuromuscular organogenesis and ligand binding and disruption of gamma subunit expression prevents the correct localization of the receptor in cell membranes. Mutations in this gene cause Escobar syndrome and a lethal form of multiple pterygium syndrome. Muscle-type acetylcholine receptor is the major antigen in the autoimmune disease myasthenia gravis.[
• Uniprot ID: Q86U77
• Protein Accession #: NP_000734
• Nucleotide Accession #: NM_000743
• Protein Size (# AA): 517
• Molecular Weight: 57kDa
• Protein Interactions: Ubqln1; CHRNB4;