CHRNG Antibody - N-terminal region (AVARP13024_P050)

Catalog No: AVARP13024_P050

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein is processed to 55 kDa and may be glycosylated.

WB Suggested Anti-CHRNG Antibody
Titration: 1 ug/ml
Positive Control: MCF7 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNG
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: NYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CHRNG (AVARP13024_P050) antibody is Catalog # AAP30681 (Previous Catalog # AAPP01338)
• Subunit: gamma
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Morgan,N.V., (2006) Am. J. Hum. Genet. 79 (2), 390-395

Target Info

• Gene Symbol: CHRNG
• Gene Full Name: Cholinergic receptor, nicotinic, gamma (muscle)
• Alias Symbols: ACHRG
• NCBI Gene Id: 1146
• Protein Name: Acetylcholine receptor subunit gamma
• Description of Target: For background information on the acetylcholine receptor (AChR), see CHRNA1. Two forms of AChR are found in mammalian skeletal muscle cells. The mature form is predominant in innervated adult muscle and the embryonic form is present in fetal and denervated muscle. Embryonic and mature AChR differ by the replacement of the gamma subunit in the pentameric glycoprotein complex by its isoform, the epsilon subunit, which is specific to the mature AChR subtype. This switch is mediated by ARIA (acetylcholine receptor-inducing activity.For background information on the acetylcholine receptor (AChR), see CHRNA1 (MIM 100690). Two forms of AChR are found in mammalian skeletal muscle cells. The mature form is predominant in innervated adult muscle and the embryonic form is present in fetal and denervated muscle. Embryonic and mature AChR differ by the replacement of the gamma subunit in the pentameric glycoprotein complex by its isoform, the epsilon subunit (MIM 100725), which is specific to the mature AChR subtype. This switch is mediated by ARIA (acetylcholine receptor-inducing activity; MIM 142445).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2187 AK125362.1 1-2187
• Uniprot ID: P07510
• Protein Accession #: NP_005190
• Nucleotide Accession #: NM_005199
• Protein Size (# AA): 517
• Molecular Weight: 58 kDa
• Protein Interactions: NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-9; KRTAP10-7; KRT31; CHRNA1;