CHRNB3 Antibody - middle region (ARP90358_P050)

Catalog No: ARP90358_P050

Host: Rabbit
Target Name: CHRNB3
Sample Tissue: Mouse Spleen lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse CHRNB3
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ILINENVDRKDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRLP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CHRNB3 (ARP90358_P050) antibody is Catalog # AAP90358

Target Info

• Gene Symbol: CHRNB3
• Gene Full Name: cholinergic receptor, nicotinic, beta polypeptide 3
• Alias Symbols: Acr, Acrb3, 5730417K16Rik
• NCBI Gene Id: 108043
• Protein Name: neuronal acetylcholine receptor subunit beta-3
• Description of Target: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
• Uniprot ID: Q8BMN3
• Protein Accession #: NP_081730.1
• Nucleotide Accession #: NM_027454.4
• Protein Size (# AA): 464
• Molecular Weight: 51 kDa